DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and Akr1b7

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_038962847.1 Gene:Akr1b7 / 116463 RGDID:620257 Length:329 Species:Rattus norvegicus


Alignment Length:288 Identity:112/288 - (38%)
Similarity:174/288 - (60%) Gaps:12/288 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 STRHALDVGYRHLDTAFVYENEAEVGQAISEKIAEGVVTREEVFVTTKLGGIHHDPALVERACRL 98
            :.:.|:|.||||.|.|:||:||:|||:||.|||.|..|.||::|:.:||.....:.:|::.|.:.
  Rat    44 AVKAAIDAGYRHFDCAYVYQNESEVGEAIQEKIKEKAVRREDLFIVSKLWSTFFEKSLMKEAFQK 108

  Fly    99 SLSNLGLEYVDLYLMHMP----VGQKF-HNDSNVHGTLELTDVDYLDTWREMEKLVDLGLTRSIG 158
            :||:|.|:|:||||:|.|    .|::| ..||  .|.:.::...:||.|..||:|||.||.:::|
  Rat   109 TLSDLKLDYLDLYLIHWPQGLQAGKEFLPKDS--QGKVLMSKSTFLDAWEGMEELVDQGLVKALG 171

  Fly   159 LSNFNAAQTERVL--ANCRIRPVVNQVECHPGFQQRQLREHAKRHGLVICAYCPLA---RPQPAR 218
            :||||..|.||:|  ...:.:||.|||||||...|.:|.::....|:.:.||.||.   ||....
  Rat   172 VSNFNHFQIERLLNKPGLKHKPVTNQVECHPYLTQEKLIQYCHSKGIAVIAYSPLGSPDRPYAKP 236

  Fly   219 QWPPFLYDEHAQNLAKKYGRTTAQICLRYLVQLGVVPLPKSSNKARIEENFRVFDFELSPDDVAG 283
            :.|..|.....:.:|.|:.:|.||:.:|:.||..|..:|||...:.|:||.:||||:||.:|:|.
  Rat   237 EDPVVLEIPKIKEIAAKHKKTIAQVLIRFHVQRNVAVIPKSVTLSHIKENIQVFDFQLSEEDMAA 301

  Fly   284 MEQYHTGQRTVPFSGMSGHKYYPFNDEF 311
            :...:...|.......|..:.:||::|:
  Rat   302 ILSLNRNWRACGLFVTSDEEDFPFHEEY 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 108/273 (40%)
Tas 6..282 CDD:223739 106/257 (41%)
Akr1b7XP_038962847.1 AKR_SF 35..329 CDD:412396 111/286 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.