DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and Akr1c14

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_598833.1 Gene:Akr1c14 / 105387 MGIID:2145458 Length:323 Species:Mus musculus


Alignment Length:326 Identity:126/326 - (38%)
Similarity:183/326 - (56%) Gaps:18/326 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTNLAPTIRLNNGREMPTLGLGTW---KSFESDAYHSTRHALDVGYRHLDTAFVYENEAEVGQAI 62
            |.:::|.:.||:|..:|.||.||.   |..:.:...:|:.|:|.|:||.|:|::|:.|.||||||
Mouse     1 MNSVSPRVVLNDGHFIPALGFGTTVPDKVPKDELIKATKIAIDTGFRHFDSAYLYQIEEEVGQAI 65

  Fly    63 SEKIAEGVVTREEVFVTTKLGGIHHDPALVERACRLSLSNLGLEYVDLYLMHMPV----GQK-FH 122
            ..||.:|.|.||::|.|:||....|.|.||......:|.|..|:|||||::|.|:    |.| |.
Mouse    66 RSKIEDGTVKREDIFYTSKLWSTFHRPELVRSCLEKTLKNAQLDYVDLYIIHFPMALQPGDKLFP 130

  Fly   123 NDSNVHGTLELTDVDYLDTWREMEKLVDLGLTRSIGLSNFNAAQTERVL--ANCRIRPVVNQVEC 185
            .|.  ||.|....||..|||..|||..|.||.:|||:||||..|.|.:|  ...:.:||.|||||
Mouse   131 RDE--HGKLLAEAVDLCDTWEAMEKCKDAGLAKSIGVSNFNFRQLETILNKPGLKYKPVCNQVEC 193

  Fly   186 HPGFQQRQLREHAKRHGLVICAYCPLARPQPARQW-----PPFLYDEHAQNLAKKYGRTTAQICL 245
            |....|.|:.::.|...:::.:||.|...:. :.|     |..|.|.....:|.||.:|.|.|.:
Mouse   194 HLYLNQSQMLDYCKSKDIILVSYCTLGSSRD-KIWVDQKSPVLLDDPVLCAMANKYKQTPALIAI 257

  Fly   246 RYLVQLGVVPLPKSSNKARIEENFRVFDFELSPDDVAGMEQYHTGQRTVPFSGMSGHKYYPFNDE 310
            ||.:|.|:|.|.:|..:.||:|..:||:|:|:.:|:..::..|...|....|....|..:||.||
Mouse   258 RYQLQRGIVVLTRSFKEKRIKEFMKVFEFQLASEDMKVLDGLHRNLRYNTASYFDDHPNHPFTDE 322

  Fly   311 F 311
            :
Mouse   323 Y 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 119/309 (39%)
Tas 6..282 CDD:223739 117/290 (40%)
Akr1c14NP_598833.1 AKR_AKR1C1-35 6..308 CDD:381334 119/304 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.