DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and AKR1A1

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001189342.1 Gene:AKR1A1 / 10327 HGNCID:380 Length:325 Species:Homo sapiens


Alignment Length:325 Identity:134/325 - (41%)
Similarity:188/325 - (57%) Gaps:20/325 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 APTIRLNNGREMPTLGLGTWKSFESDAYHSTRHALDVGYRHLDTAFVYENEAEVGQAISEKIAEG 69
            |..:.|:.|::||.:|||||||.......:.::||.|||||:|.|.:|.||.|:|:|:.|.:..|
Human     3 ASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEALKEDVGPG 67

  Fly    70 -VVTREEVFVTTKLGGIHHDPALVERACRLSLSNLGLEYVDLYLMHMPVG-QKFHN--DSNVHGT 130
             .|.|||:|||:||....|.|..||.|.|.:|::|.|||:||||||.|.. ::..|  ..|..||
Human    68 KAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGT 132

  Fly   131 LELTDVDYLDTWREMEKLVDLGLTRSIGLSNFNAAQTERVLANCRIRPVVNQVECHPGFQQRQLR 195
            :......|.:||:.:|.||..||.:::||||||:.|.:.:|:...:||.|.||||||...|.:|.
Human   133 ICYDSTHYKETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLAQNELI 197

  Fly   196 EHAKRHGLVICAYCPLARPQPARQW-----PPFLYDEHAQNLAKKYGRTTAQICLRYLVQLGVVP 255
            .|.:..||.:.||.||....  |.|     |..|.:.....||:||||:.|||.||:.||..|:.
Human   198 AHCQARGLEVTAYSPLGSSD--RAWRDPDEPVLLEEPVVLALAEKYGRSPAQILLRWQVQRKVIC 260

  Fly   256 LPKSSNKARIEENFRVFDFELSPDDVAGMEQYHTGQR-TVPFSGM--------SGHKYYPFNDEF 311
            :|||...:||.:|.:||||..||:::..:...:...| .||...:        :||..|||||.:
Human   261 IPKSITPSRILQNIKVFDFTFSPEEMKQLNALNKNWRYIVPMLTVDGKRVPRDAGHPLYPFNDPY 325

  Fly   312  311
            Human   326  325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 127/302 (42%)
Tas 6..282 CDD:223739 123/284 (43%)
AKR1A1NP_001189342.1 ARA1 6..303 CDD:223729 126/298 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1770
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.720

Return to query results.
Submit another query.