DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9436 and LOC101733893

DIOPT Version :9

Sequence 1:NP_610235.1 Gene:CG9436 / 35586 FlyBaseID:FBgn0033101 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_031746807.1 Gene:LOC101733893 / 101733893 -ID:- Length:290 Species:Xenopus tropicalis


Alignment Length:292 Identity:125/292 - (42%)
Similarity:162/292 - (55%) Gaps:38/292 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PTIRLNNGREMPTLGLGTW---KSFESDAYHSTRHALDVGYRHLDTAFVYENEAEVGQAISEKIA 67
            |.:.||:|.:||.||.||:   |..:|.|...|:.|:||||||:|.||:|.||.|||:||..|||
 Frog     7 PCVELNDGHKMPVLGFGTYAPEKFPKSLAEEGTKVAIDVGYRHIDCAFIYGNEVEVGRAIKAKIA 71

  Fly    68 EGVVTREEVFVTTKLGGIHHDPALVERACRLSLSNLGLEYVDLYLMHMPVGQK------------ 120
            :|.|.||:||.|.||....|.|..|..|...||::|.|:|:||:::|.||..|            
 Frog    72 DGTVKREDVFYTGKLWSTFHTPERVRPALEKSLTDLQLDYMDLFIIHNPVEFKPGDDPLPLDENG 136

  Fly   121 ---FHNDSNVHGTLELTDVDYLDTWREMEKLVDLGLTRSIGLSNFNAAQTERVL--ANCRIRPVV 180
               |||            .|..|||:.:||..|.||.||||:||||..|.|.:|  ...:.:||.
 Frog   137 KPIFHN------------TDLRDTWKALEKCKDAGLVRSIGVSNFNHKQLELILNMPGLKYKPVC 189

  Fly   181 NQVECHPGFQQRQLREHAKRHGLVICAYCPLARPQPARQW-----PPFLYDEHAQNLAKKYGRTT 240
            ||||||....|.:|.|..|...:|:.||..|...: ...|     |..|.:.....:|||:.||.
 Frog   190 NQVECHIYLDQSKLLEFCKSKDIVLVAYGVLGSSR-EENWVDQSTPVLLENPILGAIAKKHNRTP 253

  Fly   241 AQICLRYLVQLGVVPLPKSSNKARIEENFRVF 272
            |.:.:|||:|.|||.|.||...|||:|||:||
 Frog   254 AHVAMRYLLQRGVVVLAKSFTPARIKENFKVF 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9436NP_610235.1 ARA1 3..298 CDD:223729 125/292 (43%)
Tas 6..282 CDD:223739 125/292 (43%)
LOC101733893XP_031746807.1 AKR_AKR1C1-35 7..286 CDD:381334 125/292 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm9378
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.