DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eb1 and mapre3b

DIOPT Version :9

Sequence 1:NP_724495.2 Gene:Eb1 / 35584 FlyBaseID:FBgn0027066 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_021330664.1 Gene:mapre3b / 431717 ZFINID:ZDB-GENE-040704-6 Length:278 Species:Danio rerio


Alignment Length:302 Identity:159/302 - (52%)
Similarity:211/302 - (69%) Gaps:29/302 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAVNVYSTNVTSENLSRHDMLAWVNDCLQSQFSKIEELCTGAAYCQFMDMLFPNSVPVKRVKFRT 65
            ||||||||::|.||||||||||||||.||..::|||:||:|.|||||||||||..:.:|:|||:.
Zfish     1 MAVNVYSTSMTIENLSRHDMLAWVNDSLQLTYTKIEQLCSGVAYCQFMDMLFPGCILLKKVKFQA 65

  Fly    66 NLEHEYIQNFKILQAGFKKMSVDKIIPVDKLIKGRFQDNFEFLQWFKKFFDANYDGREYDPVAQR 130
            .||||||.|||:|||.||:|:|||||||:||:||:|||||||:|||||||||||||:||||...|
Zfish    66 KLEHEYIHNFKVLQAAFKRMNVDKIIPVEKLVKGKFQDNFEFVQWFKKFFDANYDGKEYDPQLAR 130

  Fly   131 GGVKLGNGNGHGSNGGSGVGSSNNDLHLMHRRPLQAPASGGRMPARVIASTAVSKVLPRTNNAAP 195
            .|..:......|            ::.|.|:....:.:||   |.|  .|....|.:|....|..
Zfish   131 QGQDVTPPPNPG------------EVFLFHKPKSPSRSSG---PQR--TSPTAPKTMPTPQRAIS 178

  Fly   196 ASRINACANSTGTVKKNDVSNSVNNQQIEEMSNQVMDMRINLEGLEKERDFYFSKLRDIEILCQE 260
            ::      .|||..:...:|.:..:.:|.|::.|:||:::.::|||||||||||||||||::|||
Zfish   179 ST------PSTGIRRNTPISRNGGDAEIMELNQQLMDLKLTVDGLEKERDFYFSKLRDIELICQE 237

  Fly   261 ADDAEAHPIIQKILDILYATEDGFAPP-----DDAPPEDEEY 297
             .:::::|::.||:|||||||||||||     |:.|.:.|||
Zfish   238 -HESDSNPVLGKIIDILYATEDGFAPPEDEEIDEQPQDQEEY 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eb1NP_724495.2 BIM1 16..293 CDD:227542 144/281 (51%)
CH 16..114 CDD:278723 71/97 (73%)
EB1 241..279 CDD:281288 24/37 (65%)
mapre3bXP_021330664.1 EB1 16..269 CDD:331377 142/276 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594766
Domainoid 1 1.000 173 1.000 Domainoid score I3637
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H133754
Inparanoid 1 1.050 303 1.000 Inparanoid score I2646
OMA 1 1.010 - - QHG56844
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 1 1.000 - - FOG0000490
OrthoInspector 1 1.000 - - otm26304
orthoMCL 1 0.900 - - OOG6_100898
Panther 1 1.100 - - O PTHR10623
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4252
SonicParanoid 1 1.000 - - X303
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.