DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eb1 and CG2955

DIOPT Version :9

Sequence 1:NP_724495.2 Gene:Eb1 / 35584 FlyBaseID:FBgn0027066 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_608817.1 Gene:CG2955 / 33622 FlyBaseID:FBgn0031585 Length:565 Species:Drosophila melanogaster


Alignment Length:368 Identity:82/368 - (22%)
Similarity:138/368 - (37%) Gaps:101/368 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SRHDMLAWVNDCLQSQFSKIEELCTGAAYCQFMDMLFPNSVPVKRVKFRTNLEHEYIQNFKILQA 80
            ||..:|.|:|:.|.:.:.::|||.|||.||:.:..|.|:::.:|||.......:|.:||.|:||.
  Fly    14 SRRRILGWINNNLGTTYVRLEELRTGAEYCRMLHKLQPSAIRLKRVFKEPKSHYECVQNMKLLQK 78

  Fly    81 GFKKMSVDKIIPVDKLIKGRFQDNFEFLQWFKKFFDANYD-----------------GREYDPVA 128
            ...|..|:|.||:.:|:.....::.||.||||.|:|.|:.                 ..:.|...
  Fly    79 SLLKQGVEKQIPIQRLVSRGNSESLEFAQWFKAFYDHNHQLLWPEKTEDAPKPLEKFDEKPDSFV 143

  Fly   129 QRGGVKLG--------------NGNGHGSN------------GGSGVGSSNNDLHLMHRR----- 162
            ..|..:.|              :.|..|.|            |.:.||.|.|     ||:     
  Fly   144 DTGKCRYGARCSHRLDSTVSSRHSNQSGKNFENYQKKKTTTTGSNSVGKSEN-----HRKDDSTK 203

  Fly   163 -PLQAPAS--GGRMPA------------RVIASTAVSKVLPRTNNAAPASRINACANSTGTVKKN 212
             ||.....  .|..|.            :::.|..:.|...|:|....:..:....:..   :|:
  Fly   204 HPLWGSLEDFDGYTPEVFNKTYRAAKKYKIVKSRFIRKHTKRSNKPRNSKTVRIAKSEN---QKS 265

  Fly   213 DVSNSVNNQQIEEMSNQVMDMRINLEGLEKER--DFYFSKLRDIEI-----LCQEADDAE-AHPI 269
            :.:..:::..|      |:...:...||::.|  ..|...:..:::     |.|..:..| .|.|
  Fly   266 ESAPFIDDPDI------VLATEVLASGLDEPRTTQTYMINVPGVKLGFKPNLFQYPEIIEDYHTI 324

  Fly   270 IQK----ILDILYA------------TEDGFAPPDDAPPEDEE 296
            :.|    .||.::.            |.|......|....|||
  Fly   325 LAKKCLLFLDDVHVSFHLDLGELSTLTHDIHRTETDLKKSDEE 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eb1NP_724495.2 BIM1 16..293 CDD:227542 79/363 (22%)
CH 16..114 CDD:278723 37/97 (38%)
EB1 241..279 CDD:281288 10/49 (20%)
CG2955NP_608817.1 CH 14..99 CDD:278723 31/84 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468770
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5217
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10623
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.