DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eb1 and dnmt3ba

DIOPT Version :9

Sequence 1:NP_724495.2 Gene:Eb1 / 35584 FlyBaseID:FBgn0027066 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_005167049.1 Gene:dnmt3ba / 321084 ZFINID:ZDB-GENE-050314-4 Length:1500 Species:Danio rerio


Alignment Length:188 Identity:62/188 - (32%)
Similarity:106/188 - (56%) Gaps:27/188 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAVNV-YSTNVTSENLSRHDMLAWVNDCLQSQFSKIEELCTGAAYCQFMDMLFPNSVPVKRVKFR 64
            ||.|| ...|...:..||:::|.|:|:.||:.|:::|:..:||.:||.:|:|||.::.:|:|||.
Zfish     1 MATNVSLEPNNPDDKCSRYEVLGWINETLQTNFTQVEQCRSGACFCQLIDLLFPGTINLKKVKFE 65

  Fly    65 TNLEHEYIQNFKILQAGFKKMSVDKIIPVDKLIKGRFQDNFEFLQWFKKFFDANY---------- 119
            :....:::||:.:|||.|:.:.|.:.:||::|:.|:|:.||.:|:||||||.||.          
Zfish    66 SQKRSDFMQNYGLLQAAFRDLEVTEPVPVNELLSGKFRPNFTYLKWFKKFFYANVKQERVYNAFE 130

  Fly   120 --DGREYDPVAQRGGVKLGNGNGHGSNGGSGVGSSNNDLHLMHRRPLQAPASGGRMPA 175
              ||:|..||..    .:.:.....|:..||.....:|:.:          :|||..|
Zfish   131 ARDGQEIVPVDD----VMKSPKALKSSYESGRAGEESDMEI----------NGGRRSA 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eb1NP_724495.2 BIM1 16..293 CDD:227542 57/172 (33%)
CH 16..114 CDD:278723 39/97 (40%)
EB1 241..279 CDD:281288
dnmt3baXP_005167049.1 CH 16..>91 CDD:278723 28/74 (38%)
Dnmt3b_related 902..985 CDD:99896
PHD_SF 1078..1197 CDD:304600
AdoMet_MTases 1222..1490 CDD:302624
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5217
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.