DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eb1 and dnmt3bb.2

DIOPT Version :9

Sequence 1:NP_724495.2 Gene:Eb1 / 35584 FlyBaseID:FBgn0027066 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_571461.1 Gene:dnmt3bb.2 / 30659 ZFINID:ZDB-GENE-990712-11 Length:1448 Species:Danio rerio


Alignment Length:308 Identity:71/308 - (23%)
Similarity:119/308 - (38%) Gaps:72/308 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VYSTNVTSENLSRHDMLAWVNDCLQSQFSKIEELCTGAAYCQFMDMLFPNSVPVKRVKFRTNLEH 69
            |....:..:..|..::|.|:|..||:.||::|:.|:|||:||.||::.|.|:.|.:|.|......
Zfish     2 VADVKIGDDKQSLCELLDWLNGLLQATFSQVEDTCSGAAFCQLMDIIQPGSIDVTKVNFTAEENL 66

  Fly    70 EYIQNFKILQAGFKKMSVDKIIPVDKLIKGRFQDNFEFLQWFKKFFDANY--------------- 119
            :.:.|:.:||..|.|..:.|.:.:..|:.|......:.|.|||..:|.|:               
Zfish    67 DILNNYNLLQEAFSKAQIQKELELTLLVNGDIMTTCDLLTWFKDMYDHNFAKQKCNPQVAFIKPE 131

  Fly   120 -----DGREYDPVAQRGGVKLGNGNGHGSNGGSGVGSSNNDLHLMHRRPLQAPASGGRMPARVIA 179
                 ..||::.:.:.....|.|.....||..:           .|                   
Zfish   132 VVSLKSSREFETIEKENVSSLYNTEETSSNQKT-----------QH------------------- 166

  Fly   180 STAVSKVLPRTNNAAP-ASRINACANSTGTVKKNDVSNSVNNQ---------QIEEMSNQVMDMR 234
               |.|....:.:.:| .|.|....:||.|   :|.||:||::         .|.....|.....
Zfish   167 ---VEKTSQESVSWSPLTSFIRKYGSSTLT---DDESNNVNSKDCPGQKSFGDITPFWRQTPYCL 225

  Fly   235 INLEGLEKERDFYFSKLRDIEILCQEADDAEAHPIIQKILDILYATED 282
            ..|.|:|.|.|      :...:|.....|.|......::||::|.|::
Zfish   226 YLLHGVELEDD------KKASVLLLGFFDKETGENKIRLLDVVYPTKE 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eb1NP_724495.2 BIM1 16..293 CDD:227542 70/297 (24%)
CH 16..114 CDD:278723 34/97 (35%)
EB1 241..279 CDD:281288 8/37 (22%)
dnmt3bb.2NP_571461.1 CH 16..>81 CDD:278723 25/64 (39%)
Dnmt3b_related 790..873 CDD:99896
PHD_SF 1020..1139 CDD:304600
Dcm 1163..>1325 CDD:223348
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5217
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.