DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eb1 and MAPRE3

DIOPT Version :9

Sequence 1:NP_724495.2 Gene:Eb1 / 35584 FlyBaseID:FBgn0027066 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001289979.1 Gene:MAPRE3 / 22924 HGNCID:6892 Length:281 Species:Homo sapiens


Alignment Length:301 Identity:155/301 - (51%)
Similarity:204/301 - (67%) Gaps:32/301 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAVNVYSTNVTSENLSRHDMLAWVNDCLQSQFSKIEELCTGAAYCQFMDMLFPNSVPVKRVKFRT 65
            ||||||||:|||||||||||||||||.|...::|||:||:|||||||||||||..|.:::|||:.
Human     1 MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQA 65

  Fly    66 NLEHEYIQNFKILQAGFKKMSVDKIIPVDKLIKGRFQDNFEFLQWFKKFFDANYDGREYDPVAQR 130
            .||||||.|||:|||.||||.|||||||:||:||:|||||||:|||||||||||||::|:|:..|
Human    66 KLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLAR 130

  Fly   131 GGVKLGNGNGHGSNGGSGVGSSNNDLHLMHRRPLQAPASGGRMPARVIASTAVS-KVLPRTNNAA 194
            .|..:    ....|.|..:.:.:..|            .|..:|.|...:...: :...|.:|.|
Human   131 QGQDV----APPPNPGDQIFNKSKKL------------IGTAVPQRTSPTGPKNMQTSGRLSNVA 179

  Fly   195 PASRINACANSTGTVKKNDVS----NSVNNQQIEEMSNQVMDMRINLEGLEKERDFYFSKLRDIE 255
            |     .|     .::||..|    ....:.||.|::.|::|:::.::|||||||||||||||||
Human   180 P-----PC-----ILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDGLEKERDFYFSKLRDIE 234

  Fly   256 ILCQEADDAEAHPIIQKILDILYATEDGFAPPDDAPPEDEE 296
            ::||| .::|..|:|..|:.||||||:|||||:|...|:.:
Human   235 LICQE-HESENSPVISGIIGILYATEEGFAPPEDDEIEEHQ 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eb1NP_724495.2 BIM1 16..293 CDD:227542 140/281 (50%)
CH 16..114 CDD:278723 72/97 (74%)
EB1 241..279 CDD:281288 24/37 (65%)
MAPRE3NP_001289979.1 BIM1 16..279 CDD:227542 141/286 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..181 6/28 (21%)
DCTN1-binding 217..281 37/59 (63%)
APC-binding 217..260 29/43 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 261..281 7/14 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158817
Domainoid 1 1.000 180 1.000 Domainoid score I3513
eggNOG 1 0.900 - - E1_COG5217
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 299 1.000 Inparanoid score I2716
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56844
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 1 1.000 - - FOG0000490
OrthoInspector 1 1.000 - - otm41520
orthoMCL 1 0.900 - - OOG6_100898
Panther 1 1.100 - - O PTHR10623
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4252
SonicParanoid 1 1.000 - - X303
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.