DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eb1 and ebp-2

DIOPT Version :9

Sequence 1:NP_724495.2 Gene:Eb1 / 35584 FlyBaseID:FBgn0027066 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_496438.1 Gene:ebp-2 / 174744 WormBaseID:WBGene00012156 Length:299 Species:Caenorhabditis elegans


Alignment Length:299 Identity:104/299 - (34%)
Similarity:162/299 - (54%) Gaps:22/299 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAVNVYSTNVTSENLSRHDMLAWVNDCLQSQFSKIEELCTGAAYCQFMDMLFPNSVPVKRVKFRT 65
            |.|||:.:.||::.|||.:.:||||:.|:|.|:|:||:.:||||||...:|| |::.:|:|||..
 Worm     1 MVVNVFISAVTTDTLSRKEAVAWVNNLLKSHFTKVEEMASGAAYCQLTHLLF-NAINLKKVKFNP 64

  Fly    66 NLEHEYIQNFKILQAGFKKMSVDKIIPVDKLIKGRFQDNFEFLQWFKKFFDANY--DGREYDPVA 128
            ..|.:.:.|:|:|...:|.:.:||.:.|:|:.|.:||||.||||||.||::||.  :..|||.|.
 Worm    65 RSEPDVLNNWKVLTTTWKDLGIDKPVDVEKMKKAKFQDNMEFLQWFYKFYNANLTTEPEEYDAVG 129

  Fly   129 QRGGVKLGNGNGHGSNGGSGVGSSNNDLHLMHRRPLQAPASGGRMPARVIASTAVSKVLPRT--N 191
            .|.|..|....  ||.|...|.:.        .||:.|.....|..|..:|:.||...:|.|  |
 Worm   130 ARFGEDLPALK--GSTGSRPVAAP--------ARPVAAAPPKPRPAAPAVAAPAVKASVPPTVRN 184

  Fly   192 NAAPASRINACANSTGTVKKN-DVSNSVNNQQIEEMSNQVMDMRINLEGLEKERDFYFSKLRDIE 255
            ...||.     |.|.||.:.: ..|..:..|:||:......:.....:.:|.||::|:|.|:.:|
 Worm   185 GTRPAP-----ATSAGTRRADPSASEELLKQEIEKHKAASDEWETTAKEMETEREYYYSILQRVE 244

  Fly   256 ILCQEADDAEAHPI-IQKILDILYATEDGFAPPDDAPPE 293
            .|..||:::.:..: :..:..||||..:.....|:...|
 Worm   245 SLANEAEESGSSTVDVAALKTILYAGNEDTEQVDEIENE 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eb1NP_724495.2 BIM1 16..293 CDD:227542 96/282 (34%)
CH 16..114 CDD:278723 45/97 (46%)
EB1 241..279 CDD:281288 12/38 (32%)
ebp-2NP_496438.1 CH 16..113 CDD:278723 45/97 (46%)
EB1 230..269 CDD:281288 12/38 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166339
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5217
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1295
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 1 1.000 - - FOG0000490
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100898
Panther 1 1.100 - - LDO PTHR10623
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X303
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.700

Return to query results.
Submit another query.