DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment phtf and phtf2

DIOPT Version :9

Sequence 1:NP_610232.1 Gene:phtf / 35583 FlyBaseID:FBgn0028579 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_001002305.1 Gene:phtf2 / 432376 ZFINID:ZDB-GENE-040711-4 Length:276 Species:Danio rerio


Alignment Length:267 Identity:84/267 - (31%)
Similarity:114/267 - (42%) Gaps:72/267 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KLDEIVAWYQKRIGTYDKQEWEKTVEQR----ILDGFNSVNLKNTKLKTELIDVDLVRGSTFPKA 62
            |:.:.|.||||:||.||:|.|||:||||    |..|..:...|...:|.|||||||||||.|.||
Zfish     4 KVRDAVLWYQKKIGAYDQQIWEKSVEQREIKFIRRGLRNKPKKTGHVKPELIDVDLVRGSAFAKA 68

  Fly    63 KPKQSLLTVIRLAILRYVLLPLYAQWWVKQTTPNAFGFILVLYLTQLTNWAIYVLHSSRIVPLDY 127
            ||:....::.|..|:|.|..|.:.:||.:.|:...|..:|.|||.|:....::.           
Zfish    69 KPESPWTSLTRKGIVRVVFFPFFFRWWTQVTSRAVFYLLLTLYLLQVLAALLFF----------- 122

  Fly   128 EKPPNGTLLQAEADGDASDKDADKESEEHAALLSALLIPCALSLLISLIHSQIVATNTASGVSGG 192
                                   ..|..||..|:.:.....|.||:..:|.|||:|:|... ||.
Zfish   123 -----------------------SISTPHAVPLTEVFGSTWLMLLLGTVHCQIVSTHTPKS-SGS 163

  Fly   193 SSKNKLRRISASYLSDKAATRENRVRRRKKIVRVRQVEADLSQASSNISLPNRRTATSTIEVLPR 257
            ||..|.|                  ||.:|.:|| .|..|...:|:..|              |:
Zfish   164 SSSGKRR------------------RRLRKALRV-DVRRDCDGSSTTDS--------------PQ 195

  Fly   258 PVTPLPS 264
            ...||.|
Zfish   196 EGAPLGS 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
phtfNP_610232.1 Phtf-FEM1B_bdg 3..184 CDD:288944 62/184 (34%)
phtf2NP_001002305.1 Phtf-FEM1B_bdg 5..156 CDD:288944 62/184 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595005
Domainoid 1 1.000 280 1.000 Domainoid score I1644
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D710715at2759
OrthoFinder 1 1.000 - - FOG0004060
OrthoInspector 1 1.000 - - otm24721
orthoMCL 1 0.900 - - OOG6_104992
Panther 1 1.100 - - O PTHR12680
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2811
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.850

Return to query results.
Submit another query.