DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip42C.2 and ZRT1

DIOPT Version :9

Sequence 1:NP_610231.2 Gene:Zip42C.2 / 35580 FlyBaseID:FBgn0033097 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_011259.1 Gene:ZRT1 / 852637 SGDID:S000003224 Length:376 Species:Saccharomyces cerevisiae


Alignment Length:365 Identity:71/365 - (19%)
Similarity:126/365 - (34%) Gaps:112/365 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AKIVAIVVLFLVTLIFCFIPYLLDRFYKWTQRPENNAREFKVVLCLLNFGGGVLIATTFIHMLPE 73
            |:|.::.|:..|:..|...| |:....|..:.|      ..|.|....||.||::||.|||::. 
Yeast    49 ARISSVFVILFVSTFFTMFP-LISTKVKRLRIP------LYVYLFAKYFGSGVIVATAFIHLMD- 105

  Fly    74 VVEVVNALQDCRMLAPT-PFGL----PEVLL-------CTGFYLMYCIE-------ETMHFVVRR 119
              ....|:.....:..| .:||    |.::|       .|..:....:|       :..|..::.
Yeast   106 --PAYGAIGGTTCVGQTGNWGLYSWCPAIMLTSLTFTFLTDLFSSVWVERKYGLSHDHTHDEIKD 168

  Fly   120 RQQRKLREVVTIKD-------AGEELRTEI------------VVQPEESPKEPNWLRGLGII--- 162
            ...|....|.:..|       ...:.:..:            |||..::......:...|:|   
Yeast   169 TVVRNTAAVSSENDNENGTANGSHDTKNGVEYYEDSDATSMDVVQSFQAQFYAFLILEFGVIFHS 233

  Fly   163 --VALSL----------------HELFGGMAIGLEMSV-----STVWFMTGAISVHKLVLAFCIG 204
              :.|:|                |:.|.|:.||..:|.     |..|:                 
Yeast   234 VMIGLNLGSVGDEFSSLYPVLVFHQSFEGLGIGARLSAIEFPRSKRWW----------------- 281

  Fly   205 MEIMMAHTRWLLAVVYLLVFSIVTPIGVGIGIAVSESAAANQPS--TVSGILQGLACGTLIYVVF 267
                    .|.|.|.|    .:.|||.|.||:.|.....:...:  .:||:|..::.|.|:|...
Yeast   282 --------PWALCVAY----GLTTPICVAIGLGVRTRYVSGSYTALVISGVLDAISAGILLYTGL 334

  Fly   268 FEIVAKNH-------AGIRILLSSMVGFVLMFGLQIAIGE 300
            .|::|::.       ..:|.|..:::..:...|:...||:
Yeast   335 VELLARDFIFNPQRTKDLRELSFNVICTLFGAGIMALIGK 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip42C.2NP_610231.2 Zip 9..294 CDD:280666 68/357 (19%)
ZRT1NP_011259.1 zip 31..376 CDD:273287 71/365 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1558
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I1665
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.820

Return to query results.
Submit another query.