DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip42C.2 and ZIP10

DIOPT Version :9

Sequence 1:NP_610231.2 Gene:Zip42C.2 / 35580 FlyBaseID:FBgn0033097 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_174411.2 Gene:ZIP10 / 840014 AraportID:AT1G31260 Length:364 Species:Arabidopsis thaliana


Alignment Length:322 Identity:72/322 - (22%)
Similarity:143/322 - (44%) Gaps:56/322 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KIVAIVVLFLVTLIFCFIPYL---LDRFYKWTQRPENNAREFKVVLCLLNFGGGVLIATTFIHML 71
            |:::|..:.:.:||...:|:.   :..|     :||.:  .|.:|   .:|..|::::|.|:|:|
plant    52 KLLSIFSILITSLIGVCLPFFARSIPAF-----QPEKS--HFLIV---KSFASGIILSTGFMHVL 106

  Fly    72 PEVVEVVNALQDCRMLAP---TPFGLPEVLLCTGFYLMYCIEETMHFVVRRRQQRKLR-EVVTIK 132
            |:..|::::  .|....|   .||.....::...|.||  ::.....|..:..::.|| :|.:::
plant   107 PDSFEMLSS--PCLNDNPWHKFPFAGFVAMMSAVFTLM--VDSITTSVFTKSGRKDLRADVASVE 167

  Fly   133 DAGEELRTEIVVQPEESPKEPNWLRG-----------------------LGIIVALSLHELFGGM 174
            ...:|:....|.....|...|:.|.|                       |||:|    ..:..|:
plant   168 TPDQEIGHVQVHGHVHSHTLPHNLHGENDKELGSYLQLLRYRILAIVLELGIVV----QSIVIGL 228

  Fly   175 AIGLEMSVSTVWFMTGAISVHKLVLAFCIGMEIMMAHTRWLLAVVYLLVFSIVTPIGVGIGIAVS 239
            ::|...:..|:..:..|:..|::.....:|..|:.|...|:...|....|::.||.||.:|:|:|
plant   229 SVGDTNNTCTIKGLVAALCFHQMFEGMGLGGCILQAEYGWVKKAVMAFFFAVTTPFGVVLGMALS 293

  Fly   240 ESAAANQPSTV--SGILQGLACGTLIYVVFFEIVAKNHAG------IRILLSSMVGFVLMFG 293
            ::...|.|.::  .|:|...:.|.|||:...:::|.:..|      |::.|.|....:|..|
plant   294 KTYKENSPESLITVGLLNASSAGLLIYMALVDLLAADFMGQKMQRSIKLQLKSYAAVLLGAG 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip42C.2NP_610231.2 Zip 9..294 CDD:280666 72/322 (22%)
ZIP10NP_174411.2 Zip 14..364 CDD:294300 72/322 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1558
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981397at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.