DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip42C.2 and ZIP4

DIOPT Version :9

Sequence 1:NP_610231.2 Gene:Zip42C.2 / 35580 FlyBaseID:FBgn0033097 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_001318977.1 Gene:ZIP4 / 837640 AraportID:AT1G10970 Length:374 Species:Arabidopsis thaliana


Alignment Length:370 Identity:89/370 - (24%)
Similarity:143/370 - (38%) Gaps:94/370 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DQHLIVAKIVAIVVLFLVTLIFCFIPYLLDRFYKWTQRPENNAREFKVVLCLLNFGGGVLIATTF 67
            |....:.|.|||..:.|.......|| |:.|..::.|...|      :.:....|..||::||.|
plant    21 DSAAFLLKFVAIASILLAGAAGVAIP-LIGRNRRFLQTEGN------LFVAAKAFAAGVILATGF 78

  Fly    68 IHMLPEVVEVVNALQDCRMLAP-TPFGLPEVLLCTGFYLMYCIEETM--HFV----VRRRQQRKL 125
            :|||....|.::  ..|....| :.|..|      ||:.|.....|:  .|:    ..|:|:|  
plant    79 VHMLAGGTEALS--NPCLPDFPWSKFPFP------GFFAMVAALATLLVDFMGTQYYERKQER-- 133

  Fly   126 REVVTIKDAGEELRTEIVVQP-------------EE----------------------------- 148
            .:..|...||.|   ||.|.|             ||                             
plant   134 NQAATEAAAGSE---EIAVVPVVGERVTDNKVFGEEDGGGIHIVGIRAHAAHHRHSHSNSHGTCD 195

  Fly   149 -------------SPKEPNWLRGLGIIVALSL----HELFGGMAIGLEMSVSTVWFMTGAISVHK 196
                         :....|..|.:.:...|.|    |.:..|:::|:..|..|:..:..|:|.|:
plant   196 GHAHGHSHGHMHGNSDVENGARHVVVSQILELGIVSHSIIIGLSLGVSQSPCTIRPLIAALSFHQ 260

  Fly   197 LVLAFCIGMEIMMAHTRWLLAVVYLLVFSIVTPIGVGIGIAVSESAAANQPSTV--SGILQGLAC 259
            ....|.:|..|..|..|...|.:....|::.||:|:|||.||:.|..::.|..:  .|||..|:.
plant   261 FFEGFALGGCISQAQFRNKSATIMACFFALTTPLGIGIGTAVASSFNSHSPGALVTEGILDSLSA 325

  Fly   260 GTLIYVVFFEIVAKNHAGIRI---LLSSMVGFVLMF---GLQIAI 298
            |.|:|:...:::|.:....|:   |...:|.:|::|   ||..|:
plant   326 GILVYMALVDLIAADFLSKRMSCNLRLQVVSYVMLFLGAGLMSAL 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip42C.2NP_610231.2 Zip 9..294 CDD:280666 85/358 (24%)
ZIP4NP_001318977.1 zip 10..374 CDD:273287 89/370 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1558
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981397at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.