DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip42C.2 and IRT1

DIOPT Version :9

Sequence 1:NP_610231.2 Gene:Zip42C.2 / 35580 FlyBaseID:FBgn0033097 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_567590.3 Gene:IRT1 / 827713 AraportID:AT4G19690 Length:347 Species:Arabidopsis thaliana


Alignment Length:314 Identity:71/314 - (22%)
Similarity:131/314 - (41%) Gaps:51/314 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KIVAIVVLFLVTLIFCFIPYLLDRFYKWTQRPENNAREFKVVLCLLNFGGGVLIATTFIHMLPEV 74
            |::||.|:.:.::|....| |..|...:.| |:.|.  |.::.|   |..|:::.|.|:|:||:.
plant    52 KVIAIFVILIASMIGVGAP-LFSRNVSFLQ-PDGNI--FTIIKC---FASGIILGTGFMHVLPDS 109

  Fly    75 VEVVNALQDCRMLAP---TPFGLPEVLLCTGFYLMYCIEETMHFVVRRRQQRKLREVVTIKDA-- 134
            .|:::::  |....|   .||        :||..|      :..::..........:.|.|:|  
plant   110 FEMLSSI--CLEENPWHKFPF--------SGFLAM------LSGLITLAIDSMATSLYTSKNAVG 158

  Fly   135 --------GEELRTEIVVQ-PEESPKEPNWLR--------GLGIIVALSLHELFGGMAIGLEMSV 182
                    |.....::.:. .|:.......||        .|||||    |.:..|:::|.....
plant   159 IMPHGHGHGHGPANDVTLPIKEDDSSNAQLLRYRVIAMVLELGIIV----HSVVIGLSLGATSDT 219

  Fly   183 STVWFMTGAISVHKLVLAFCIGMEIMMAHTRWLLAVVYLLVFSIVTPIGVGIGIAVSESAAANQP 247
            .|:..:..|:..|::.....:|..|:.|....:...|....|::.||.|:.:|||:|.....|.|
plant   220 CTIKGLIAALCFHQMFEGMGLGGCILQAEYTNMKKFVMAFFFAVTTPFGIALGIALSTVYQDNSP 284

  Fly   248 STV--SGILQGLACGTLIYVVFFEIVAKNHAGIRILLSSMVGFVLMFGLQIAIG 299
            ..:  .|:|...:.|.|||:...:::|....|.::..|..:.|..:....:..|
plant   285 KALITVGLLNACSAGLLIYMALVDLLAAEFMGPKLQGSIKMQFKCLIAALLGCG 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip42C.2NP_610231.2 Zip 9..294 CDD:280666 70/307 (23%)
IRT1NP_567590.3 Zip 6..347 CDD:412377 71/314 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1558
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981397at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.