DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip42C.2 and ZIP3

DIOPT Version :9

Sequence 1:NP_610231.2 Gene:Zip42C.2 / 35580 FlyBaseID:FBgn0033097 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_180786.1 Gene:ZIP3 / 817787 AraportID:AT2G32270 Length:339 Species:Arabidopsis thaliana


Alignment Length:323 Identity:75/323 - (23%)
Similarity:131/323 - (40%) Gaps:85/323 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KIVAIVVLFLVTLIFCFIPYLLDRFYKWTQRPENNAREFKVVLCLL----NFGGGVLIATTFIHM 70
            ||.||..:.:..:|....| ||.:.:. :.|||.         |..    .|..||::||.|:|:
plant    54 KIAAIPTVLIAGIIGVLFP-LLGKVFP-SLRPET---------CFFFVTKAFAAGVILATGFMHV 107

  Fly    71 LPEVVEVVNALQDCRMLAPTPFGLP----------------EVLLCTGFYLMYCIEETMHFVVRR 119
            |||..|::|:  .|  |....:..|                :....:.||..:|           
plant   108 LPEAYEMLNS--PC--LTSEAWEFPFTGFIAMIAAILTLSVDTFATSSFYKSHC----------- 157

  Fly   120 RQQRKLREVVTIKDAGEE---------LRTEIVVQPEESPKEPNWLRGLGIIVALSLHELFGGMA 175
                |..:.|:..:.||.         |||.::.|..|          |||||    |.:..|::
plant   158 ----KASKRVSDGETGESSVDSEKVQILRTRVIAQVLE----------LGIIV----HSVVIGIS 204

  Fly   176 IGLEMSVSTVWFMTGAISVHKLVLAFCIGMEIMMAHTRWLLAVVYLLVFSIVTPIGVGIGIAVSE 240
            :|...|......:..|:..|:......:|..|.....:.|...:....|:|.||||:.:|:.::.
plant   205 LGASQSPDAAKALFIALMFHQCFEGLGLGGCIAQGKFKCLSVTIMSTFFAITTPIGIVVGMGIAN 269

  Fly   241 SAAANQPST--VSGILQGLACGTLIYVVFFEIVA--------KNHAGIRIL--LSSMVGFVLM 291
            |...:.|:.  |.|:|...:.|.|||:...:::|        :::.|::|:  ::.::|..||
plant   270 SYDESSPTALIVQGVLNAASAGILIYMSLVDLLAADFTHPKMQSNTGLQIMAHIALLLGAGLM 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip42C.2NP_610231.2 Zip 9..294 CDD:280666 75/323 (23%)
ZIP3NP_180786.1 zip 38..339 CDD:273287 75/323 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1558
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981397at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.