DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip42C.2 and ZIP7

DIOPT Version :9

Sequence 1:NP_610231.2 Gene:Zip42C.2 / 35580 FlyBaseID:FBgn0033097 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_178488.1 Gene:ZIP7 / 814931 AraportID:AT2G04032 Length:365 Species:Arabidopsis thaliana


Alignment Length:316 Identity:77/316 - (24%)
Similarity:135/316 - (42%) Gaps:52/316 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KIVAIVVLFLVTLIFCFIPYLLDRFYKWTQRPENNAREFKVVLCLLNFGGGVLIATTFIHMLPEV 74
            ||:||..:.:.::|...:| |..|... ...|:   ||..|::..|  ..||::||.|:|:||:.
plant    56 KIIAIPSILVASMIGVSLP-LFSRSIP-ALGPD---REMSVIVKTL--ASGVILATGFMHVLPDS 113

  Fly    75 VEVVNALQDCRMLAPTP---FGLPEVLLCTGFYLMYCIEETMHFVVRRRQQRKLREVVTIKDAGE 136
            .:.:.:    :.|...|   |.....:......|:..||........||..::..|||.:::...
plant   114 FDDLTS----KCLPEDPWQKFPFATFITMISALLVLMIESFAMCAYARRTSKREGEVVPLENGSN 174

  Fly   137 ELRTEIVVQPEES-------------PKEPNWLRG--------LGIIVALSLHELFGGMAIGLEM 180
            .:.|:..:|..|:             .|....||.        |||:|    |.:..|:|:|...
plant   175 SVDTQNDIQTLENGSSYVEKQEKVNEDKTSELLRNKVIAQILELGIVV----HSVVIGLAMGASD 235

  Fly   181 SVSTVWFMTGAISVHKLVLAFCIGMEIMMAH----TRWLLAVVYLLVFSIVTPIGVGIGIAVSES 241
            :..||..:..|:..|:|.....:|..|:.|.    |.|.:    :..||:.||.|:.:|:|:.:.
plant   236 NKCTVQSLIAALCFHQLFEGMGLGGSILQAQFKSKTNWTM----VFFFSVTTPFGIVLGMAIQKI 296

  Fly   242 AAANQPST--VSGILQGLACGTLIYVVFFEIVAKNHAGIRI---LLSSMVGFVLMF 292
            .....|:.  |.|:|...:.|.|||:....::|....|.:|   :...::|:|..|
plant   297 YDETSPTALIVVGVLNACSAGLLIYMALVNLLAHEFFGPKIQGNIKLHVLGYVATF 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip42C.2NP_610231.2 Zip 9..294 CDD:280666 77/316 (24%)
ZIP7NP_178488.1 Zip 37..365 CDD:412377 77/316 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1558
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981397at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.