DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip42C.2 and SLC39A3

DIOPT Version :9

Sequence 1:NP_610231.2 Gene:Zip42C.2 / 35580 FlyBaseID:FBgn0033097 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_653165.2 Gene:SLC39A3 / 29985 HGNCID:17128 Length:314 Species:Homo sapiens


Alignment Length:323 Identity:91/323 - (28%)
Similarity:154/323 - (47%) Gaps:51/323 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LIVAKIVAIVVLFLVTLIFCFIPYLLDRFYKWTQRPENNAREFKVVLCLLN-FGGGVLIATTFIH 69
            |:||||:.:|.:|...|:...:|      .|..:.....|...|.:|.|.| |||||.:||.|..
Human     4 LLVAKILCMVGVFFFMLLGSLLP------VKIIETDFEKAHRSKKILSLCNTFGGGVFLATCFNA 62

  Fly    70 MLPEVVEVVNALQDCRMLAPTPFGLPEVLLCTGFYLMYCIEETMHFVVRRRQQRKLREVVTI--- 131
            :||.|.|.:..:.....:: |.:.|.|.:|..||::...:|:.:  :..|:::....::.|.   
Human    63 LLPAVREKLQKVLSLGHIS-TDYPLAETILLLGFFMTVFLEQLI--LTFRKEKPSFIDLETFNAG 124

  Fly   132 KDAGEELRTE-----------IVVQP-------------EESPKEPNWLRGLGIIVALSLHELFG 172
            .|.|.:...|           :.|:|             ..||     :|.|.:..|||.|.:|.
Human   125 SDVGSDSEYESPFMGGARGHALYVEPHGHGPSLSVQGLSRASP-----VRLLSLAFALSAHSVFE 184

  Fly   173 GMAIGLEMSVSTVWFMTGAISVHKLVLAFCIGMEIMMAHTRWLL--AVVYLLVFSIVTPIGVGIG 235
            |:|:||:.....|..:...::||:.::|..:|  |.||.:...|  |....:..|.:.|:|:|:|
Human   185 GLALGLQEEGEKVVSLFVGVAVHETLVAVALG--ISMARSAMPLRDAAKLAVTVSAMIPLGIGLG 247

  Fly   236 IAVSESAAANQPSTVSGILQGLACGTLIYVVFFEIVAK--NHAGIRIL--LSSMVGFVLMFGL 294
            :.: |||.....|..|.:|||||.||.:::.|.||:||  .....|:|  |..::|:.::.|:
Human   248 LGI-ESAQGVPGSVASVLLQGLAGGTFLFITFLEILAKELEEKSDRLLKVLFLVLGYTVLAGM 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip42C.2NP_610231.2 Zip 9..294 CDD:280666 88/318 (28%)
SLC39A3NP_653165.2 Zip 5..309 CDD:396884 89/320 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1558
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H44230
Inparanoid 1 1.050 120 1.000 Inparanoid score I4770
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D471714at33208
OrthoFinder 1 1.000 - - FOG0000574
OrthoInspector 1 1.000 - - mtm8626
orthoMCL 1 0.900 - - OOG6_100840
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X561
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.730

Return to query results.
Submit another query.