DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip42C.2 and Slc39a2

DIOPT Version :9

Sequence 1:NP_610231.2 Gene:Zip42C.2 / 35580 FlyBaseID:FBgn0033097 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_001034765.2 Gene:Slc39a2 / 214922 MGIID:2684326 Length:309 Species:Mus musculus


Alignment Length:309 Identity:70/309 - (22%)
Similarity:129/309 - (41%) Gaps:67/309 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LIVAKIVAIVVLFLVTLIFCFIPYLLDRFYKWTQRPENNAREFKVVLCLLNFGGGVLIATTFIHM 70
            |:..||..::.|.::||.....|.    :.||.|.........:|:..|.....||.:....:||
Mouse     4 LLGVKIGCLLALLVLTLGCGLTPI----YVKWFQMDAATGHHHRVLSLLGCTSAGVFLGAGLMHM 64

  Fly    71 LPEVVEVV-----------------NALQD-CRMLAPTPFGLPEVLLCTGFYLMYCIE----ETM 113
            ..|.:|.:                 |:.:| .......|:|  |:::..||:.::.:|    :..
Mouse    65 TAEALEGIESEIQKFVEQNSTGSKGNSSRDAASSYVEYPYG--ELVISLGFFFVFLLESLALQCC 127

  Fly   114 HFVVRRRQQRKLREVVTIKDAGEELRTE--------------IVVQPEESPKEPNWLRGLGIIVA 164
            |...                .|..::.|              .|..|...|     ||.|.::::
Mouse   128 HGAA----------------GGSTVQEEEWGGTHAFGFHKHPAVPSPSRGP-----LRALVLLLS 171

  Fly   165 LSLHELFGGMAIGLEMSVSTVWFMTGAISVHKLVLAFCIGMEIMMAHT--RWLLAVVYLLVFSIV 227
            ||.|.:|.|:|:||:.:|:....:..|:..||.::.|.:|:.:....|  ||  |...:|..:::
Mouse   172 LSFHSVFEGLAVGLQATVAATIQLCVAVLAHKGLVVFSVGLRLGKIGTGPRW--ATFCILSLALM 234

  Fly   228 TPIGVGIGIAVSESAAANQPSTVSGILQGLACGTLIYVVFFEIVAKNHA 276
            :|:|:.:|:.|:..|:.........:|:|:|.||.:||.|.||:.:..|
Mouse   235 SPVGLALGLTVAGGASGQTQGLAQAVLEGIAAGTFLYVTFLEILPRELA 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip42C.2NP_610231.2 Zip 9..294 CDD:280666 69/306 (23%)
Slc39a2NP_001034765.2 Zip 5..306 CDD:280666 69/308 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1558
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 117 1.000 Inparanoid score I4793
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D471714at33208
OrthoFinder 1 1.000 - - FOG0000574
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11040
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X561
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.930

Return to query results.
Submit another query.