DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip42C.1 and ZIP9

DIOPT Version :9

Sequence 1:NP_525107.1 Gene:Zip42C.1 / 35579 FlyBaseID:FBgn0033096 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001329099.1 Gene:ZIP9 / 829439 AraportID:AT4G33020 Length:391 Species:Arabidopsis thaliana


Alignment Length:347 Identity:80/347 - (23%)
Similarity:130/347 - (37%) Gaps:77/347 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DHHALLVAKIVSMVVLVVITVLCGSLPYV-----LNRCFHWTKASPEETRSSLVVRCLLFFGGGV 75
            |..|.|..|..:|..:::......|:|.|     ||               ..::|....|..||
plant    36 DDAAALTLKFAAMASILISGAAGVSIPLVGTLLPLN---------------GGLMRGAKAFAAGV 85

  Fly    76 LICTTFLHMLPEVIEVVEALQECGSLVKTP---FALAEMLLCTGFFLMYALDELMTSLVRHHQGK 137
            ::.|.|:|||....:.:.  ..|  |.:.|   |...|........|....|.::|......|.|
plant    86 ILATGFVHMLSGGSKALS--DPC--LPEFPWKMFPFPEFFAMVAALLTLLADFMITGYYERKQEK 146

  Fly   138 LSRKESVASLAF------------------ERGRSI------------RHSVLLNPQAKEEVEVK 172
            : ..:||.||..                  |.|.::            |||:.:..:..|.:. |
plant   147 M-MNQSVESLGTQVSVMSDPGLESGFLRDQEDGGALHIVGMRAHAEHHRHSLSMGAEGFEALS-K 209

  Fly   173 DTEPQPHKDHHGHSHMPVPADDG------SSARGLGIILALSLHELFEGMAIGLEGTVSTVWFMF 231
            .:....|...|.|.|..|..|.|      |....:||:    .|.:..|:::|:..:..|:..:.
plant   210 RSGVSGHGHGHSHGHGDVGLDSGVRHVVVSQILEMGIV----SHSIIIGISLGVSHSPCTIRPLL 270

  Fly   232 GAVSAHKLVLAFCVGMELLVARTRSSLAILYLVTFSIVTPIGIGVGLGI-----SQQVAAGQPSL 291
            .|:|.|:....|.:|..:..||.....:.:....|:|.||||:.||..|     |..|||   .:
plant   271 LALSFHQFFEGFALGGCVAEARLTPRGSAMMAFFFAITTPIGVAVGTAIASSYNSYSVAA---LV 332

  Fly   292 PSGVLQGIACGTLLYVVFFEIL 313
            ..|||..::.|.|:|:...:::
plant   333 AEGVLDSLSAGILVYMALVDLI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip42C.1NP_525107.1 Zip 21..336 CDD:280666 78/342 (23%)
ZIP9NP_001329099.1 Zip 26..391 CDD:412377 80/347 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1558
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981397at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.