DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip42C.1 and IRT1

DIOPT Version :9

Sequence 1:NP_525107.1 Gene:Zip42C.1 / 35579 FlyBaseID:FBgn0033096 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_567590.3 Gene:IRT1 / 827713 AraportID:AT4G19690 Length:347 Species:Arabidopsis thaliana


Alignment Length:377 Identity:77/377 - (20%)
Similarity:151/377 - (40%) Gaps:97/377 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ATATMSQEQTQDVDHHALLVAKIVSMVVLVVITVLCGSLPYVLNRCFHWTKASPEETRS------ 61
            ||:|..:|...:..:..:..||.:.:.|:.:..:|..|:..|         .:|..:|:      
plant    26 ATSTAPEECGSESANPCVNKAKALPLKVIAIFVILIASMIGV---------GAPLFSRNVSFLQP 81

  Fly    62 ----SLVVRCLLFFGGGVLICTTFLHMLPEVIEVVEALQECGSLVKTP---FALAEMLLCTGFFL 119
                ..:::|   |..|:::.|.|:|:||:..|::.::  |  |.:.|   |..:..|......:
plant    82 DGNIFTIIKC---FASGIILGTGFMHVLPDSFEMLSSI--C--LEENPWHKFPFSGFLAMLSGLI 139

  Fly   120 MYALDELMTSLVRHHQGKLSRKESVASLAFERGRSIRHSVLLNPQAKEEVEVKDTEPQPHKDHHG 184
            ..|:|.:.|||       .:.|.:|..:                              ||  .||
plant   140 TLAIDSMATSL-------YTSKNAVGIM------------------------------PH--GHG 165

  Fly   185 HSH-------MPVPADDGSSA-----RGLGIILALSL--HELFEGMAIGLEGTVSTVWFMFGAVS 235
            |.|       :|:..||.|:|     |.:.::|.|.:  |.:..|:::|......|:..:..|:.
plant   166 HGHGPANDVTLPIKEDDSSNAQLLRYRVIAMVLELGIIVHSVVIGLSLGATSDTCTIKGLIAALC 230

  Fly   236 AHKLVLAFCVGMELLVARTRSSLAILYLVTFSIVTPIGIGVGLGISQQVAAGQPS--LPSGVLQG 298
            .|::.....:|..:|.|...:....:....|::.||.||.:|:.:|.......|.  :..|:|..
plant   231 FHQMFEGMGLGGCILQAEYTNMKKFVMAFFFAVTTPFGIALGIALSTVYQDNSPKALITVGLLNA 295

  Fly   299 IACGTLLYVVFFEILIESHAG----------WRALVAAVAGFALMFGLQILS 340
            .:.|.|:|:...::|.....|          ::.|:||:.|..   |:.|::
plant   296 CSAGLLIYMALVDLLAAEFMGPKLQGSIKMQFKCLIAALLGCG---GMSIIA 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip42C.1NP_525107.1 Zip 21..336 CDD:280666 71/353 (20%)
IRT1NP_567590.3 Zip 6..347 CDD:412377 77/377 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1558
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981397at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.