DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip42C.1 and ZIP3

DIOPT Version :9

Sequence 1:NP_525107.1 Gene:Zip42C.1 / 35579 FlyBaseID:FBgn0033096 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_180786.1 Gene:ZIP3 / 817787 AraportID:AT2G32270 Length:339 Species:Arabidopsis thaliana


Alignment Length:373 Identity:85/373 - (22%)
Similarity:142/373 - (38%) Gaps:118/373 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EQTQDVDHHALLVAK--IVSMVVLVVITVLCGSLPYVLNRCFHWTKASPEETRSSLVVRCLLF-- 70
            |.:.:.||.....|:  .::.:..|:|..:.|.|..:|.:.|  ....||        .|..|  
plant    37 ECSHEDDHENKAGARKYKIAAIPTVLIAGIIGVLFPLLGKVF--PSLRPE--------TCFFFVT 91

  Fly    71 --FGGGVLICTTFLHMLPEVIEVVEALQECGSLVKTPFALAEMLLCTGFFLMYA------LDELM 127
              |..||::.|.|:|:|||..|::.:........:.||        |||..|.|      :|...
plant    92 KAFAAGVILATGFMHVLPEAYEMLNSPCLTSEAWEFPF--------TGFIAMIAAILTLSVDTFA 148

  Fly   128 TSLVRHHQGKLSRKES-----VASLAFERGRSIR--------------HSVLLNPQAKEEVEVKD 173
            ||.......|.|::.|     .:|:..|:.:.:|              |||::....        
plant   149 TSSFYKSHCKASKRVSDGETGESSVDSEKVQILRTRVIAQVLELGIIVHSVVIGISL-------- 205

  Fly   174 TEPQPHKDHHGHSHMPVPADDGSSARGLGIILALSLHELFEGMAIGLEGTVSTVWFMFGAVSAHK 238
                      |.|..|    |.:.|    :.:||..|:.|||:.:|            |.::..|
plant   206 ----------GASQSP----DAAKA----LFIALMFHQCFEGLGLG------------GCIAQGK 240

  Fly   239 LVLAFCVGMELLVARTRSSLAILYLVT-FSIVTPIGIGVGLGISQQVAAGQPS--LPSGVLQGIA 300
            .                ..|::..:.| |:|.|||||.||:||:.......|:  :..|||...:
plant   241 F----------------KCLSVTIMSTFFAITTPIGIVVGMGIANSYDESSPTALIVQGVLNAAS 289

  Fly   301 CGTLLYVVFFEIL--------IESHAGWRALVAAVAGFALMFGLQILS 340
            .|.|:|:...::|        ::|:.|    :..:|..||:.|..::|
plant   290 AGILIYMSLVDLLAADFTHPKMQSNTG----LQIMAHIALLLGAGLMS 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip42C.1NP_525107.1 Zip 21..336 CDD:280666 80/356 (22%)
ZIP3NP_180786.1 zip 38..339 CDD:273287 84/372 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1558
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981397at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.