DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip42C.1 and ZIP6

DIOPT Version :9

Sequence 1:NP_525107.1 Gene:Zip42C.1 / 35579 FlyBaseID:FBgn0033096 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_180569.1 Gene:ZIP6 / 817559 AraportID:AT2G30080 Length:341 Species:Arabidopsis thaliana


Alignment Length:347 Identity:75/347 - (21%)
Similarity:139/347 - (40%) Gaps:76/347 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KIVSMVVLVVITVLCGSLPYVLNRCFHWTKASPEETRSSLVVRCLLFFGGGVLICTTFLHMLPEV 88
            |||::..:.:.:|.....|.:|.:.||   ..|...::.||::|   |..||::.|:.:|:|||.
plant    27 KIVAVFAIFLTSVFGVWGPVLLAKYFH---GKPLYDKAILVIKC---FAAGVILSTSLVHVLPEA 85

  Fly    89 IEVVEALQECGSLVKTP---FALAEMLLCTGFFLMYALDELMTSL-VRHHQGK------------ 137
            .   |:|.:|....:.|   |..|.::...|     |:..|:..| ...|.|.            
plant    86 F---ESLADCQVSSRHPWKDFPFAGLVTMIG-----AITALLVDLTASEHMGHGGGGGGDGGMEY 142

  Fly   138 LSRKESVASLAFERGRSIRHSVLLNPQAKEEVEVKDTEPQPHKDHHGHSHMPVPADDGSSARGLG 202
            :...::|..|..:.|:......:.....:|.|::|....                   |....:|
plant   143 MPVGKAVGGLEMKEGKCGADLEIQENSEEEIVKMKQRLV-------------------SQVLEIG 188

  Fly   203 IILALSLHELFEGMAIGLEGTVSTVWFMFGAVSAHKLVLAFCVGMELLVARTRSSLAILYLVTFS 267
            ||    .|.:..|:.:|:.....|:..:..|:|.|::.....:|..:..|..::...:...:.|:
plant   189 II----FHSVIIGVTMGMSQNKCTIRPLIAALSFHQIFEGLGLGGCIAQAGFKAGTVVYMCLMFA 249

  Fly   268 IVTPIGIGVGLGISQQVAAG----QPS--LPSGVLQGIACGTLLYVVFFEILI------------ 314
            :.||:||.:|:.|.  .|.|    .|:  :..|:|...:.|.|:|:...:::.            
plant   250 VTTPLGIVLGMVIF--AATGYDDQNPNALIMEGLLGSFSSGILIYMALVDLIALDFFHNKMLTTC 312

  Fly   315 -ESHAGWRAL--VAAVAGFALM 333
             ||.:..:.|  ||.|.|.|.|
plant   313 GESGSRLKKLCFVALVLGSASM 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip42C.1NP_525107.1 Zip 21..336 CDD:280666 75/347 (22%)
ZIP6NP_180569.1 zip 14..341 CDD:273287 75/347 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1558
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981397at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.