DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip42C.1 and Slc39a1

DIOPT Version :9

Sequence 1:NP_525107.1 Gene:Zip42C.1 / 35579 FlyBaseID:FBgn0033096 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001128049.1 Gene:Slc39a1 / 361986 RGDID:1305241 Length:324 Species:Rattus norvegicus


Alignment Length:330 Identity:96/330 - (29%)
Similarity:160/330 - (48%) Gaps:51/330 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LVAKIVSMVVLVVITVLCGSLPY-VLNRCFHWTKASPEETRSSLVVRCLLFFGGGVLICTTFLHM 84
            |..|:.::|:|:::|::|..:|. ||.|.....:||....::..:|.|   |.|||.:.|..|.:
  Rat    27 LEVKLGALVLLLLLTLICSLVPVCVLRRSGANHEASASGQKALSLVSC---FAGGVFLATCLLDL 88

  Fly    85 LPEVI----EVVEALQECGSLVKTPFALAEMLLCTGFFLMYALDELMTSLVRHHQGKLSRKESVA 145
            ||:.:    |.:|||.     |...|.|.|.:|..||||:..::::          .|:.||..:
  Rat    89 LPDYLAAIDEALEALH-----VTLQFPLQEFILAMGFFLVLVMEQI----------TLAYKEQSS 138

  Fly   146 SLAFERGRSIRHSVLLNPQAKEEVEVKDTEPQPHKDHHGHSHMPVPADDG-----SSARGLGIIL 205
            ....|..|::..:|...||                  |.|....:|...|     |:.|...::.
  Rat   139 PPHPEETRALLGTVNGGPQ------------------HWHDGPGIPQASGTPAAPSALRACVLVF 185

  Fly   206 ALSLHELFEGMAIGLEGTVSTVWFMFGAVSAHKLVLAFCVGMELLVARTRSSLAILYLVTFSIVT 270
            :|:||.:|||:|:||:...:....:..|:..||.:||..:.:.||.:..|:.:.....:.||.:|
  Rat   186 SLALHSVFEGLAVGLQRDRARAMELCLALLLHKGILAVSLSLRLLQSHLRAQVVAGCGILFSCMT 250

  Fly   271 PIGIGVGLGISQQVAAGQPSLPSGVLQGIACGTLLYVVFFEILIE----SHAGWRALVAAVAGFA 331
            |:|||:|..:::. |.....|...||:|:|.||.||:.|.|||.:    |......::..:||||
  Rat   251 PLGIGLGAALAES-AGPLHQLAQSVLEGMAAGTFLYITFLEILPQELATSEQRILKVILLLAGFA 314

  Fly   332 LMFGL 336
            |:.||
  Rat   315 LLTGL 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip42C.1NP_525107.1 Zip 21..336 CDD:280666 94/328 (29%)
Slc39a1NP_001128049.1 Zip 48..319 CDD:396884 88/307 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I5803
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I4700
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D471714at33208
OrthoFinder 1 1.000 - - FOG0000574
OrthoInspector 1 1.000 - - mtm9105
orthoMCL 1 0.900 - - OOG6_100840
Panther 1 1.100 - - O PTHR11040
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X561
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.970

Return to query results.
Submit another query.