DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip42C.1 and Slc39a3

DIOPT Version :9

Sequence 1:NP_525107.1 Gene:Zip42C.1 / 35579 FlyBaseID:FBgn0033096 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001008357.1 Gene:Slc39a3 / 314637 RGDID:1310863 Length:317 Species:Rattus norvegicus


Alignment Length:349 Identity:105/349 - (30%)
Similarity:160/349 - (45%) Gaps:66/349 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LLVAKIVSMVVLVVITVLCGSLPY-VLNRCFHWTKASPEETRSSLVVRCLLFFGGGVLICTTFLH 83
            |||||::.||.:....:|...||. |:...|.  ||.    ||..|:.....|||||.:.|.|..
  Rat     4 LLVAKVLCMVGVFFFMLLGSLLPVKVIEADFE--KAH----RSKKVLSLCNTFGGGVFLATCFNA 62

  Fly    84 MLPEVIEVVEALQECGSLVKTPFALAEMLLCTGFFLMYALDELMTSLVRH----------HQGKL 138
            :||.|.:.::.:...|. :.|.:.|||.|:..||||...:::|:.:..|.          :.|..
  Rat    63 LLPAVRDKLQQVLSLGH-ISTDYPLAETLMMVGFFLTVFVEQLVLTFRRERPPFIDLETFNAGSD 126

  Fly   139 SRKESVASLAFERGRSIRHSVLLNPQAKEEVEVKDTEPQPHKDHHGHSH----------MPVPAD 193
            :..:|.....|.......|.:...|.|                   |||          .|.|  
  Rat   127 AGSDSEYESPFVGVGGRNHGLYPEPTA-------------------HSHGTGLRLRELGRPGP-- 170

  Fly   194 DGSSARGLGIILALSLHELFEGMAIGLEGTVSTVWFMFGAVSAHKLVLAFCVGMELLVARTRSSL 258
                .|.|.::.|||.|.:|||:|:||:.....|..:|..|:.|:.::|..:|:.:  ||:...|
  Rat   171 ----LRLLSLVFALSAHSVFEGLALGLQEEGERVVSLFVGVAVHETLVAVALGISM--ARSAVPL 229

  Fly   259 --AILYLVTFSIVTPIGIGVGLGI--SQQVAAGQPSLPSGVLQGIACGTLLYVVFFEILI----E 315
              |....||.|.:.|:|||:||||  ::.||:   |:.|.:|||:|.||.|:|.|.|||.    |
  Rat   230 RDAAKLAVTVSAMIPVGIGLGLGIESARSVAS---SVASALLQGLAGGTFLFVTFLEILAKELEE 291

  Fly   316 SHAGWRALVAAVAGFALMFGLQIL 339
            .......::..|.|:|::.|:..|
  Rat   292 RSEQLLKVLFLVLGYAVLAGMVFL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip42C.1NP_525107.1 Zip 21..336 CDD:280666 102/343 (30%)
Slc39a3NP_001008357.1 Zip 5..312 CDD:396884 102/343 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353023
Domainoid 1 1.000 116 1.000 Domainoid score I5803
eggNOG 1 0.900 - - E1_KOG1558
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H44230
Inparanoid 1 1.050 118 1.000 Inparanoid score I4700
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D471714at33208
OrthoFinder 1 1.000 - - FOG0000574
OrthoInspector 1 1.000 - - mtm9105
orthoMCL 1 0.900 - - OOG6_100840
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X561
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.700

Return to query results.
Submit another query.