DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip42C.1 and SLC39A3

DIOPT Version :9

Sequence 1:NP_525107.1 Gene:Zip42C.1 / 35579 FlyBaseID:FBgn0033096 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_653165.2 Gene:SLC39A3 / 29985 HGNCID:17128 Length:314 Species:Homo sapiens


Alignment Length:350 Identity:104/350 - (29%)
Similarity:160/350 - (45%) Gaps:71/350 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LLVAKIVSMVVLVVITVLCGSLPY-VLNRCFHWTKASPEETRSSLVVRCLLFFGGGVLICTTFLH 83
            ||||||:.||.:....:|...||. ::...|.  ||.    ||..::.....|||||.:.|.|..
Human     4 LLVAKILCMVGVFFFMLLGSLLPVKIIETDFE--KAH----RSKKILSLCNTFGGGVFLATCFNA 62

  Fly    84 MLPEVIEVVEALQECGSLVKTPFALAEMLLCTGFFLMYALDELMTSLVRHHQGKLSRKESVASLA 148
            :||.|.|.::.:...|. :.|.:.|||.:|..|||:...|::|:.:.         |||..:.:.
Human    63 LLPAVREKLQKVLSLGH-ISTDYPLAETILLLGFFMTVFLEQLILTF---------RKEKPSFID 117

  Fly   149 FE------------------RGRSIRHSVLLNPQAKEEVEVKDTEPQPHKDHHGHSHMPVPADDG 195
            .|                  .|.:..|::.:.|                     |.|.|..:..|
Human   118 LETFNAGSDVGSDSEYESPFMGGARGHALYVEP---------------------HGHGPSLSVQG 161

  Fly   196 ----SSARGLGIILALSLHELFEGMAIGLEGTVSTVWFMFGAVSAHKLVLAFCVGMELLVARTRS 256
                |..|.|.:..|||.|.:|||:|:||:.....|..:|..|:.|:.::|..:|:.:  ||:..
Human   162 LSRASPVRLLSLAFALSAHSVFEGLALGLQEEGEKVVSLFVGVAVHETLVAVALGISM--ARSAM 224

  Fly   257 SL--AILYLVTFSIVTPIGIGVGLGISQQVAAGQP-SLPSGVLQGIACGTLLYVVFFEILI---- 314
            .|  |....||.|.:.|:|||:||||  :.|.|.| |:.|.:|||:|.||.|::.|.|||.    
Human   225 PLRDAAKLAVTVSAMIPLGIGLGLGI--ESAQGVPGSVASVLLQGLAGGTFLFITFLEILAKELE 287

  Fly   315 ESHAGWRALVAAVAGFALMFGLQIL 339
            |.......::..|.|:.::.|:..|
Human   288 EKSDRLLKVLFLVLGYTVLAGMVFL 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip42C.1NP_525107.1 Zip 21..336 CDD:280666 101/344 (29%)
SLC39A3NP_653165.2 Zip 5..309 CDD:396884 101/344 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159010
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1558
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H44230
Inparanoid 1 1.050 120 1.000 Inparanoid score I4770
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D471714at33208
OrthoFinder 1 1.000 - - FOG0000574
OrthoInspector 1 1.000 - - mtm8626
orthoMCL 1 0.900 - - OOG6_100840
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X561
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.660

Return to query results.
Submit another query.