DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chk and CG8389

DIOPT Version :9

Sequence 1:NP_001163063.1 Gene:chk / 35578 FlyBaseID:FBgn0033095 Length:894 Species:Drosophila melanogaster
Sequence 2:NP_611076.2 Gene:CG8389 / 36764 FlyBaseID:FBgn0034063 Length:471 Species:Drosophila melanogaster


Alignment Length:179 Identity:52/179 - (29%)
Similarity:89/179 - (49%) Gaps:10/179 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 MPDGGYGWVVVFASLVVSLIADGLSFSFGLINVELLEYFGESTSKTAWIS-----SLFFSVPLLM 191
            :|||||||:||.|..::::....:...||.:.|..|:...|.|...|.|:     :|.|| .|.:
  Fly     9 VPDGGYGWIVVAAVALINMTNQSILSVFGQLFVGELQKMQEDTFTAALITNLNSLALNFS-GLFI 72

  Fly   192 GPIWSNLVDKYGCRKMTILGGVVSAFGFALSSFCNSIEMLMVTFGIISGLGLGIGYVTAVVSIAF 256
            ||    .:..:..|.:...|.::.|.|.||.:|.:.....::.:....|.|||:...:..::|..
  Fly    73 GP----AIKSFKPRNVAATGCILVALGLALCAFASESWHFILGYSFFVGFGLGLISPSTFMAINS 133

  Fly   257 WFDKKRTFATGIGASGTGIGTFVYARLTSYLIESYGWRGATLILGGTML 305
            :|..||..|.|:..:|.|:|..:...|..||::::|:|.|.|.:....|
  Fly   134 YFTTKRGRAVGVSLAGAGLGQVLIPHLVRYLLDNHGFRYAVLSMSSLSL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chkNP_001163063.1 MFS 143..>315 CDD:119392 43/168 (26%)
MFS <685..869 CDD:119392
CG8389NP_611076.2 MFS 19..425 CDD:119392 44/169 (26%)
MFS_1 19..400 CDD:284993 44/169 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2504
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11360
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.