DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chk and Slc16a11

DIOPT Version :9

Sequence 1:NP_001163063.1 Gene:chk / 35578 FlyBaseID:FBgn0033095 Length:894 Species:Drosophila melanogaster
Sequence 2:XP_038941393.1 Gene:Slc16a11 / 287450 RGDID:1311125 Length:593 Species:Rattus norvegicus


Alignment Length:217 Identity:70/217 - (32%)
Similarity:120/217 - (55%) Gaps:16/217 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 GDSIDSSSTEKKTPKM----------PDGGYGWVVVFASLVVSLIADGLSFSFGLINVELLEYFG 171
            |..:::|.|....|:.          ||||:||||..|:..|:.::.||..|.||...:|.|:|.
  Rat   129 GPGVETSFTGVSPPQQTAMTPKPAGPPDGGWGWVVAAAAFAVNGLSYGLLRSLGLALPDLAEHFE 193

  Fly   172 ESTSKTAWISSLFFSVPLLMGPIWSNLVDKYGCRKMTILGGVVSAFGFALSSFCNSIEMLMVTFG 236
            .|...|||:|:|..:|.....|:.|.|..::|.|.:.::|||:::.|...|:|..|:..|.:..|
  Rat   194 RSAQDTAWVSALALAVQQAASPVGSALSTRWGARPVVMVGGVLTSLGLVFSAFARSLLHLYLGLG 258

  Fly   237 IISGLGLGIGYVTAVVSIAFWFDKKRTFATGIGASGTGIGTFVYARLTSYLIESYGWRGATLILG 301
            :::|.|..:.:..|:.:::.:|.::|..|.|:..:|.|..:.:.|....:|::::|||||.|:||
  Rat   259 LLAGSGWALVFAPALGTLSRYFSRRRVLAVGLALTGNGASSLLLAPALQFLLDTFGWRGALLLLG 323

  Fly   302 GTMLNACVCGALMR------DP 317
            ...|:...||||:|      ||
  Rat   324 AVTLHLTPCGALLRPLALSGDP 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chkNP_001163063.1 MFS 143..>315 CDD:119392 55/171 (32%)
MFS <685..869 CDD:119392
Slc16a11XP_038941393.1 PHA03378 <42..158 CDD:223065 6/28 (21%)
MFS_MCT11_13 160..549 CDD:340981 62/186 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2504
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000033
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11360
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X70
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.