DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chk and Slc16a11

DIOPT Version :9

Sequence 1:NP_001163063.1 Gene:chk / 35578 FlyBaseID:FBgn0033095 Length:894 Species:Drosophila melanogaster
Sequence 2:NP_694721.2 Gene:Slc16a11 / 216867 MGIID:2663709 Length:447 Species:Mus musculus


Alignment Length:198 Identity:69/198 - (34%)
Similarity:115/198 - (58%) Gaps:9/198 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 TPK---MPDGGYGWVVVFASLVVSLIADGLSFSFGLINVELLEYFGESTSKTAWISSLFFSVPLL 190
            |||   .||||:||||..|:..|:.::.||..|.||...:|.|:|..|...|||:|:|..:|...
Mouse     2 TPKPAGPPDGGWGWVVAAAAFAVNGLSYGLLRSLGLALPDLAEHFERSAQDTAWVSALALAVQQA 66

  Fly   191 MGPIWSNLVDKYGCRKMTILGGVVSAFGFALSSFCNSIEMLMVTFGIISGLGLGIGYVTAVVSIA 255
            ..|:.|.|..::|.|.:.::|||:::.|...|:|..|:..|.:..|:::|.|..:.:..|:.:::
Mouse    67 ASPVGSALSTRWGARPVVMVGGVLTSLGLVFSAFARSLLHLYLGLGLLAGSGWALVFAPALGTLS 131

  Fly   256 FWFDKKRTFATGIGASGTGIGTFVYARLTSYLIESYGWRGATLILGGTMLNACVCGALMR----- 315
            .:|.::|..|.|:..:|.|..:.:.|....:|::::|||||.|:||...|:...||||:|     
Mouse   132 RYFSRRRVLAVGLALTGNGASSLLLAPALQFLLDTFGWRGALLLLGAVTLHLTPCGALLRPLALS 196

  Fly   316 -DP 317
             ||
Mouse   197 GDP 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chkNP_001163063.1 MFS 143..>315 CDD:119392 55/171 (32%)
MFS <685..869 CDD:119392
Slc16a11NP_694721.2 MFS 14..403 CDD:391944 62/186 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000033
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11360
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X70
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.