DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chk and slcf-1

DIOPT Version :9

Sequence 1:NP_001163063.1 Gene:chk / 35578 FlyBaseID:FBgn0033095 Length:894 Species:Drosophila melanogaster
Sequence 2:NP_509762.2 Gene:slcf-1 / 186633 WormBaseID:WBGene00010340 Length:450 Species:Caenorhabditis elegans


Alignment Length:228 Identity:58/228 - (25%)
Similarity:92/228 - (40%) Gaps:50/228 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 GWVVVFASLVVSLIADGLSFSFGLINVELLEYFGESTSKT-----AWISSLFFSVP----LLMGP 193
            |:.::||...|..:.:|               |.|...||     ....:....||    |::||
 Worm    43 GFYILFAETGVRQVMNG---------------FVEPVIKTYNCTKDQADTAVLVVPMASSLILGP 92

  Fly   194 IWSNLVDKYGCRKMTILGGVVSAFGFALSSFCNSIEMLMV-TFGIISGLGLGIGYV-TAVVSI-A 255
            ..|....:.|.|...|.|..::...|.:..||.:|.:||: ||    |:|:|.|.: .:::|| .
 Worm    93 FCSIFYQRSGARISIIAGSFLTGGSFVVGPFCKNIYLLMLATF----GMGIGCGLMRNSIISIQC 153

  Fly   256 FWFDKKRTFATGIGASGTGIGTFVYARLTSYLIESY-GWRGATLILGGTMLNACVCGALMRDPDW 319
            .:|.|||.......:.|.|:|.|:..|...:::..| .|..|...|....:.:.:.|..:..|. 
 Worm   154 EYFKKKRNTVMAAISIGPGLGIFILPRTLKFIMVKYNSWGPAWWFLSLFYIVSAIMGLFITKPP- 217

  Fly   320 LIEENRLESRSQSVTTFSNSS---VCLEEIKKL 349
                      |:..:|||..|   ||    |||
 Worm   218 ----------SEQTSTFSFGSAFKVC----KKL 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chkNP_001163063.1 MFS 143..>315 CDD:119392 46/184 (25%)
MFS <685..869 CDD:119392
slcf-1NP_509762.2 MFS 44..410 CDD:119392 57/227 (25%)
MFS_1 79..376 CDD:284993 49/177 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2504
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.