DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chk and SLC16A11

DIOPT Version :9

Sequence 1:NP_001163063.1 Gene:chk / 35578 FlyBaseID:FBgn0033095 Length:894 Species:Drosophila melanogaster
Sequence 2:NP_001357478.1 Gene:SLC16A11 / 162515 HGNCID:23093 Length:447 Species:Homo sapiens


Alignment Length:182 Identity:63/182 - (34%)
Similarity:109/182 - (59%) Gaps:0/182 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 PDGGYGWVVVFASLVVSLIADGLSFSFGLINVELLEYFGESTSKTAWISSLFFSVPLLMGPIWSN 197
            ||||:||||..|:..::.::.||..|.||...:|.|:|..|...|||||:|..:|.....|:.|.
Human     9 PDGGWGWVVAAAAFAINGLSYGLLRSLGLAFPDLAEHFDRSAQDTAWISALALAVQQAASPVGSA 73

  Fly   198 LVDKYGCRKMTILGGVVSAFGFALSSFCNSIEMLMVTFGIISGLGLGIGYVTAVVSIAFWFDKKR 262
            |..::|.|.:.::|||:::.||..|:|.:.:..|.:..|:::|.|..:.:..|:.:::.:|.::|
Human    74 LSTRWGARPVVMVGGVLASLGFVFSAFASDLLHLYLGLGLLAGFGWALVFAPALGTLSRYFSRRR 138

  Fly   263 TFATGIGASGTGIGTFVYARLTSYLIESYGWRGATLILGGTMLNACVCGALM 314
            ..|.|:..:|.|..:.:.|.....|::::|||||.|:||...|:...||||:
Human   139 VLAVGLALTGNGASSLLLAPALQLLLDTFGWRGALLLLGAITLHLTPCGALL 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chkNP_001163063.1 MFS 143..>315 CDD:119392 55/172 (32%)
MFS <685..869 CDD:119392
SLC16A11NP_001357478.1 MFS 14..403 CDD:355786 59/177 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000033
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11360
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X70
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.