DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chk and slc16a13

DIOPT Version :9

Sequence 1:NP_001163063.1 Gene:chk / 35578 FlyBaseID:FBgn0033095 Length:894 Species:Drosophila melanogaster
Sequence 2:NP_001090862.1 Gene:slc16a13 / 100038279 XenbaseID:XB-GENE-5905916 Length:516 Species:Xenopus tropicalis


Alignment Length:178 Identity:56/178 - (31%)
Similarity:99/178 - (55%) Gaps:0/178 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 GWVVVFASLVVSLIADGLSFSFGLINVELLEYFGESTSKTAWISSLFFSVPLLMGPIWSNLVDKY 202
            |.|::.:..:.:.:..|...|.|:.....:|.|..:....:|::|...:|..|:.|:..:|..::
 Frog    13 GAVLLLSCFMQAGLVFGTVRSLGVFFPAFVENFESAAGSVSWVTSCGVAVQQLLSPLGCSLALRF 77

  Fly   203 GCRKMTILGGVVSAFGFALSSFCNSIEMLMVTFGIISGLGLGIGYVTAVVSIAFWFDKKRTFATG 267
            |.|.:.||||::||.|...:||...:..|.:..|.:||||..:.:...:.::..:|.::|:.|||
 Frog    78 GSRPVVILGGLLSALGMFFASFATELYQLYLCIGGLSGLGWAMIFSPTMAAVTCYFKRRRSLATG 142

  Fly   268 IGASGTGIGTFVYARLTSYLIESYGWRGATLILGGTMLNACVCGALMR 315
            ....|.|:.:|..:.|..||:|:|.||||.|:|.|..|::..||||:|
 Frog   143 FVLMGVGVFSFALSPLLQYLLETYSWRGALLLLSGLALHSVPCGALLR 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chkNP_001163063.1 MFS 143..>315 CDD:119392 53/171 (31%)
MFS <685..869 CDD:119392
slc16a13NP_001090862.1 MFS_MCT11_13 13..392 CDD:340981 56/178 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000033
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X70
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.