DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab2 and RABG3B

DIOPT Version :10

Sequence 1:NP_477090.1 Gene:Rab2 / 35577 FlyBaseID:FBgn0014009 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_173688.1 Gene:RABG3B / 838880 AraportID:AT1G22740 Length:203 Species:Arabidopsis thaliana


Alignment Length:167 Identity:63/167 - (37%)
Similarity:99/167 - (59%) Gaps:7/167 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQEAFRS 70
            |.|.||:||:||||:.|:.|:.:.:|...:..|||.:|..:.:.||.:.:.||||||||||.|:|
plant     8 LLKVIILGDSGVGKTSLMNQYVNNKFSQQYKATIGADFVTKELQIDDRLVTLQIWDTAGQERFQS 72

  Fly    71 ITRSYYRGAAGALLVYDITRRETFNHLTTW----LEDARQHSNSNMVIMLIGNKSDLD--SRREV 129
            :..::||||...:||||:...::|..|..|    |..|..........:|:|||.|:|  :.|.|
plant    73 LGVAFYRGADCCVLVYDVNHLKSFESLDNWHNEFLTRASPRDPMAFPFILLGNKVDIDGGNSRVV 137

  Fly   130 KKEEGEAFAREHG-LVFMETSARTAANVEEAFINTAK 165
            .:::...:..|.| :|:.||||:...||:::|:...|
plant   138 SEKKAREWCAEKGNIVYFETSAKEDYNVDDSFLCITK 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab2NP_477090.1 PLN03108 1..213 CDD:178655 63/167 (38%)
RABG3BNP_173688.1 Rab7 9..180 CDD:206655 62/166 (37%)

Return to query results.
Submit another query.