DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab2 and RABB1C

DIOPT Version :9

Sequence 1:NP_001260732.1 Gene:Rab2 / 35577 FlyBaseID:FBgn0014009 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_193450.1 Gene:RABB1C / 827428 AraportID:AT4G17170 Length:211 Species:Arabidopsis thaliana


Alignment Length:216 Identity:166/216 - (76%)
Similarity:183/216 - (84%) Gaps:9/216 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQ 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||.|.|||||||||||
plant     1 MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDNKPIKLQIWDTAGQ 65

  Fly    66 EAFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDSRREVK 130
            |:||||||||||||||||||||||||||||||.:||||||||:|:||.|||||||.||..||.|.
plant    66 ESFRSITRSYYRGAAGALLVYDITRRETFNHLASWLEDARQHANANMTIMLIGNKCDLAHRRAVS 130

  Fly   131 KEEGEAFAREHGLVFMETSARTAANVEEAFINTAKEIYEKIQEGVFDINNEANGIKIGQQHSPTN 195
            .||||.||:||||:|||.||:||.|||||||.||..||:|||:||||::||:.|||:|.      
plant   131 TEEGEQFAKEHGLIFMEASAKTAQNVEEAFIKTAATIYKKIQDGVFDVSNESYGIKVGY------ 189

  Fly   196 PSLPG-AGGAAGAAN--SGCC 213
            ..:|| :||..|:.:  .|||
plant   190 GGIPGPSGGRDGSTSQGGGCC 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab2NP_001260732.1 PLN03108 1..213 CDD:178655 164/214 (77%)
RABB1CNP_193450.1 PLN03108 1..210 CDD:178655 164/214 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 280 1.000 Domainoid score I399
eggNOG 1 0.900 - - E2759_KOG0098
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H20628
Inparanoid 1 1.050 329 1.000 Inparanoid score I682
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271975at2759
OrthoFinder 1 1.000 - - FOG0002747
OrthoInspector 1 1.000 - - otm3178
orthoMCL 1 0.900 - - OOG6_101535
Panther 1 1.100 - - O PTHR47979
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1831
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.