DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab2 and RABB1a

DIOPT Version :9

Sequence 1:NP_001260732.1 Gene:Rab2 / 35577 FlyBaseID:FBgn0014009 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_193449.1 Gene:RABB1a / 827427 AraportID:AT4G17160 Length:205 Species:Arabidopsis thaliana


Alignment Length:217 Identity:150/217 - (69%)
Similarity:168/217 - (77%) Gaps:17/217 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQ 65
            |||||.||||||||||||||||||:|||||||.||||||||||||:.||||.|.|||||||||||
plant     1 MSYAYRFKYIIIGDTGVGKSCLLLKFTDKRFQAVHDLTIGVEFGAKTITIDNKPIKLQIWDTAGQ 65

  Fly    66 EAFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDSRREVK 130
            |:|||:|||||||.||.|||||||||||||||.:|||:||||::.||..||||||.||:.:|.|.
plant    66 ESFRSVTRSYYRGRAGTLLVYDITRRETFNHLASWLEEARQHASENMTTMLIGNKCDLEDKRTVS 130

  Fly   131 KEEGEAFAREHGLVFMETSARTAANVEEAFINTAKEIYEKIQEGVFDINNEANGIKIGQQHSPTN 195
            .||||.|||||||:|||.||:||.||||||:.||..||::||:||.|..||. ||          
plant   131 TEEGEQFAREHGLIFMEASAKTAHNVEEAFVETAATIYKRIQDGVVDEANEP-GI---------- 184

  Fly   196 PSLPGAGGAAGAANS----GCC 213
              .||..|...|::|    |||
plant   185 --TPGPFGGKDASSSQQRRGCC 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab2NP_001260732.1 PLN03108 1..213 CDD:178655 148/215 (69%)
RABB1aNP_193449.1 PLN03108 1..204 CDD:178655 148/215 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 280 1.000 Domainoid score I399
eggNOG 1 0.900 - - E2759_KOG0098
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 329 1.000 Inparanoid score I682
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271975at2759
OrthoFinder 1 1.000 - - FOG0002747
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47979
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1831
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.930

Return to query results.
Submit another query.