DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab2 and Rab2a

DIOPT Version :9

Sequence 1:NP_001260732.1 Gene:Rab2 / 35577 FlyBaseID:FBgn0014009 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_113906.1 Gene:Rab2a / 65158 RGDID:68323 Length:212 Species:Rattus norvegicus


Alignment Length:215 Identity:192/215 - (89%)
Similarity:201/215 - (93%) Gaps:5/215 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQ 65
            |:||||||||||||||||||||||||||||||||||||:||||||||||||||||||||||||||
  Rat     1 MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTMGVEFGARMITIDGKQIKLQIWDTAGQ 65

  Fly    66 EAFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDSRREVK 130
            |:||||||||||||||||||||||||:|||||||||||||||||||||||||||||||:||||||
  Rat    66 ESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVK 130

  Fly   131 KEEGEAFAREHGLVFMETSARTAANVEEAFINTAKEIYEKIQEGVFDINNEANGIKIGQQHSPTN 195
            |||||||||||||:||||||:||:||||||||||||||||||||||||||||||||||.||:.||
  Rat   131 KEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNEANGIKIGPQHAATN 195

  Fly   196 PSLPGAGGAAGA--ANSGCC 213
            .|   .||..|.  |..|||
  Rat   196 AS---HGGNQGGQQAGGGCC 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab2NP_001260732.1 PLN03108 1..213 CDD:178655 190/213 (89%)
Rab2aNP_113906.1 Required for interaction with PRKCI. /evidence=ECO:0000250 2..19 15/16 (94%)
Rab2 3..170 CDD:206658 159/166 (96%)
RAB 7..170 CDD:197555 155/162 (96%)
Effector region. /evidence=ECO:0000250 35..43 6/7 (86%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 190..212 10/24 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340789
Domainoid 1 1.000 314 1.000 Domainoid score I1254
eggNOG 1 0.900 - - E2759_KOG0098
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H20628
Inparanoid 1 1.050 383 1.000 Inparanoid score I1977
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271975at2759
OrthoFinder 1 1.000 - - FOG0002747
OrthoInspector 1 1.000 - - oto97933
orthoMCL 1 0.900 - - OOG6_101535
Panther 1 1.100 - - LDO PTHR47979
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1831
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.