DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab2 and Rab2a

DIOPT Version :9

Sequence 1:NP_001260732.1 Gene:Rab2 / 35577 FlyBaseID:FBgn0014009 Length:213 Species:Drosophila melanogaster
Sequence 2:XP_006538189.1 Gene:Rab2a / 59021 MGIID:1928750 Length:216 Species:Mus musculus


Alignment Length:200 Identity:159/200 - (79%)
Similarity:172/200 - (86%) Gaps:19/200 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQ 65
            |:|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse     1 MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQ 65

  Fly    66 EAFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDSRREVK 130
            |:||||||||||||||||||||||||:|||||||||||||||||||||||||||||||:||||||
Mouse    66 ESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVK 130

  Fly   131 KEEGEAFAREHGLVFMETSARTAANVEEAFINTAKEIYEKIQEGVFDINN--EANGIKIG----- 188
            |||||||||||||:||||||:||:||||. :|.         |....:|:  :|.|..:|     
Mouse   131 KEEGEAFAREHGLIFMETSAKTASNVEEV-MNA---------ESTVQMNHCQDAGGCCMGGSVKT 185

  Fly   189 --QQH 191
              :||
Mouse   186 IKRQH 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab2NP_001260732.1 PLN03108 1..213 CDD:178655 158/199 (79%)
Rab2aXP_006538189.1 Rab2 3..158 CDD:206658 148/154 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837072
Domainoid 1 1.000 316 1.000 Domainoid score I1278
eggNOG 1 0.900 - - E2759_KOG0098
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H20628
Inparanoid 1 1.050 384 1.000 Inparanoid score I2021
Isobase 1 0.950 - 0 Normalized mean entropy S200
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002747
OrthoInspector 1 1.000 - - oto94417
orthoMCL 1 0.900 - - OOG6_101535
Panther 1 1.100 - - LDO PTHR47979
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3432
SonicParanoid 1 1.000 - - X1831
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.770

Return to query results.
Submit another query.