DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab2 and RAB2A

DIOPT Version :9

Sequence 1:NP_001260732.1 Gene:Rab2 / 35577 FlyBaseID:FBgn0014009 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_002856.1 Gene:RAB2A / 5862 HGNCID:9763 Length:212 Species:Homo sapiens


Alignment Length:213 Identity:191/213 - (89%)
Similarity:200/213 - (93%) Gaps:1/213 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQ 65
            |:|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Human     1 MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQ 65

  Fly    66 EAFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDSRREVK 130
            |:||||||||||||||||||||||||:|||||||||||||||||||||||||||||||:||||||
Human    66 ESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVK 130

  Fly   131 KEEGEAFAREHGLVFMETSARTAANVEEAFINTAKEIYEKIQEGVFDINNEANGIKIGQQHSPTN 195
            |||||||||||||:||||||:||:||||||||||||||||||||||||||||||||||.||:.||
Human   131 KEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNEANGIKIGPQHAATN 195

  Fly   196 PSLPGAGGAAGAANSGCC 213
            .:..|..|.. .|..|||
Human   196 ATHAGNQGGQ-QAGGGCC 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab2NP_001260732.1 PLN03108 1..213 CDD:178655 189/211 (90%)
RAB2ANP_002856.1 PLN03108 1..188 CDD:178655 179/186 (96%)
Required for interaction with PRKCI. /evidence=ECO:0000269|PubMed:14570876 2..19 15/16 (94%)
Effector region. /evidence=ECO:0000250 35..43 7/7 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147127
Domainoid 1 1.000 316 1.000 Domainoid score I1275
eggNOG 1 0.900 - - E2759_KOG0098
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H20628
Inparanoid 1 1.050 384 1.000 Inparanoid score I2051
Isobase 1 0.950 - 0 Normalized mean entropy S200
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271975at2759
OrthoFinder 1 1.000 - - FOG0002747
OrthoInspector 1 1.000 - - oto90834
orthoMCL 1 0.900 - - OOG6_101535
Panther 1 1.100 - - LDO PTHR47979
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3432
SonicParanoid 1 1.000 - - X1831
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1514.780

Return to query results.
Submit another query.