DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab2 and rab2b

DIOPT Version :9

Sequence 1:NP_001260732.1 Gene:Rab2 / 35577 FlyBaseID:FBgn0014009 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001005636.1 Gene:rab2b / 448102 XenbaseID:XB-GENE-920598 Length:215 Species:Xenopus tropicalis


Alignment Length:217 Identity:179/217 - (82%)
Similarity:196/217 - (90%) Gaps:6/217 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQ 65
            ||||||||||||||||||||||||||||||||||||||||||||||||.||||.|||||||||||
 Frog     1 MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMINIDGKPIKLQIWDTAGQ 65

  Fly    66 EAFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDSRREVK 130
            |:|||||||||||||||||||||||||||:|||:|||||||||:|||||:||||||||:|||:|.
 Frog    66 ESFRSITRSYYRGAAGALLVYDITRRETFSHLTSWLEDARQHSSSNMVIILIGNKSDLESRRDVS 130

  Fly   131 KEEGEAFAREHGLVFMETSARTAANVEEAFINTAKEIYEKIQEGVFDINNEANGIKIGQQHSPTN 195
            :||||||||||||:||||||:||||||||||:||||||:|||:|:||:||||||||:|.|.|...
 Frog   131 REEGEAFAREHGLIFMETSAKTAANVEEAFIDTAKEIYKKIQQGLFDVNNEANGIKVGPQQSINE 195

  Fly   196 PSLPGAG----GAAGAANSGCC 213
            |.  |:|    ...|...||||
 Frog   196 PL--GSGLRQNQNEGGGTSGCC 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab2NP_001260732.1 PLN03108 1..213 CDD:178655 177/215 (82%)
rab2bNP_001005636.1 PLN03108 1..215 CDD:178655 177/215 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11702
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53521
OrthoDB 1 1.010 - - D1271975at2759
OrthoFinder 1 1.000 - - FOG0002747
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47979
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1831
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.030

Return to query results.
Submit another query.