DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab2 and Rab18

DIOPT Version :9

Sequence 1:NP_001260732.1 Gene:Rab2 / 35577 FlyBaseID:FBgn0014009 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_524744.2 Gene:Rab18 / 44360 FlyBaseID:FBgn0015794 Length:197 Species:Drosophila melanogaster


Alignment Length:182 Identity:79/182 - (43%)
Similarity:120/182 - (65%) Gaps:8/182 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQEAFRSIT 72
            |.::||::|||||.|:.:|.:.:|...||:|||::|.::::.:||...|:.:|||||.|.|||:|
  Fly     7 KLLVIGESGVGKSSLIRRFVENKFDQNHDVTIGMDFKSKVMQVDGIDYKVALWDTAGAERFRSLT 71

  Fly    73 RSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHS-NSNMVIMLIGNKSDLDSRREVKKEEGEA 136
            .|:||.|.||:||||||.|::...|.|||.:...:| |.|:.|:::|||  :|..|.|.:|||..
  Fly    72 PSFYRKALGAILVYDITSRDSLVKLETWLAELDSYSDNPNIAIIVVGNK--IDEERVVDREEGRK 134

  Fly   137 FAREHGLVFMETSARTAANVEEAFINTAKEIYEKI-QEGVFDINNEANGIKI 187
            |||:|..:|:||||:....|.:.|    |::.||| ....|:..|.:.|:.|
  Fly   135 FARKHRALFIETSAKCDQFVSDVF----KDVVEKIVSSEYFNNGNASAGLDI 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab2NP_001260732.1 PLN03108 1..213 CDD:178655 79/182 (43%)
Rab18NP_524744.2 RAB 6..166 CDD:197555 74/164 (45%)
Rab18 6..165 CDD:206656 73/163 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454212
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.