DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab2 and Rab19

DIOPT Version :9

Sequence 1:NP_001260732.1 Gene:Rab2 / 35577 FlyBaseID:FBgn0014009 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001261575.1 Gene:Rab19 / 38930 FlyBaseID:FBgn0015793 Length:219 Species:Drosophila melanogaster


Alignment Length:212 Identity:90/212 - (42%)
Similarity:132/212 - (62%) Gaps:15/212 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQEA 67
            :.:|||.::|||.|.||:|::.:|....:...|..||||:|..:.|.::|||||||||||||||.
  Fly    18 FDFLFKIVLIGDCGTGKTCIVDRFKTGNYIERHGNTIGVDFSMKTIAVEGKQIKLQIWDTAGQER 82

  Fly    68 FRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDSRREVKKE 132
            ||:||:||||.|.|.|:|||||:|.:|::|..|:|:.|:::.||::|:|:|||.||:.:|||..|
  Fly    83 FRTITQSYYRSANGVLIVYDITKRSSFSNLQKWIEEVRRYTASNVLIILVGNKCDLEEQREVDFE 147

  Fly   133 EGEAFAR--EHGLVFMETSARTAANVEEAFINTAKEIYEKIQEGVFDINNEANGIKIGQQHSPTN 195
            |.....:  ...|..|||||:...|||:||...|.|:..:         ::||.:    :..|.|
  Fly   148 EARQMCQYIPEILFVMETSAKENMNVEDAFRCLANELKRQ---------HDANNV----EEVPEN 199

  Fly   196 PSLPGAGGAAGAANSGC 212
            ....|.|....:.:|.|
  Fly   200 TITLGQGKPLKSCSSSC 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab2NP_001260732.1 PLN03108 1..213 CDD:178655 90/212 (42%)
Rab19NP_001261575.1 Rab19 19..184 CDD:133267 81/164 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454136
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.