DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab2 and RabX5

DIOPT Version :9

Sequence 1:NP_001260732.1 Gene:Rab2 / 35577 FlyBaseID:FBgn0014009 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_647644.2 Gene:RabX5 / 38209 FlyBaseID:FBgn0035255 Length:277 Species:Drosophila melanogaster


Alignment Length:216 Identity:67/216 - (31%)
Similarity:102/216 - (47%) Gaps:17/216 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQEAFRSIT 72
            |.|.:||..|||:.::.:|...:||..:..||||:|.....:|.|....|::|||||||.||.|.
  Fly    66 KVIFVGDCSVGKTAIVNRFCYDKFQSNYKATIGVDFELENFSILGHNYSLEMWDTAGQERFRCIA 130

  Fly    73 RSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNM-VIMLIGNKSDLDSRREVKKEEGEA 136
            .:|||.|:..::.||::::::......||..|..::.|.. ::.|:|.|:||.|:.|..:.|..|
  Fly   131 GAYYRNASVIVVTYDMSKKDSLESAKKWLNSALNYNASKRPLVFLVGTKADLLSKEEFVRMERLA 195

  Fly   137 --FAREHGLVFMETSARTAANVEEAFINTAKEIYEKIQEGVFDINNEANGIKIGQQHSPTNPSLP 199
              .|.|....:...|||:...|.|.|...|...:|:.      :..|...||...|...|..|:.
  Fly   196 GLAAAELQAEYWSVSARSGFKVTELFQRIAALAFEEA------VMQEIRSIKNKPQEQATQASVK 254

  Fly   200 GA--------GGAAGAANSGC 212
            ..        |.......|||
  Fly   255 SQTFDLRNFFGSRLSQQKSGC 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab2NP_001260732.1 PLN03108 1..213 CDD:178655 67/216 (31%)
RabX5NP_647644.2 P-loop_NTPase 66..230 CDD:304359 56/163 (34%)
RAB 66..225 CDD:197555 55/158 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454221
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.