DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab2 and RabX6

DIOPT Version :9

Sequence 1:NP_001260732.1 Gene:Rab2 / 35577 FlyBaseID:FBgn0014009 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster


Alignment Length:220 Identity:75/220 - (34%)
Similarity:111/220 - (50%) Gaps:31/220 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KYIIIGDTGVGKSCLLLQFTDKRFQPVHD--LTIGVEFGARMITIDGKQIKLQIWDTAGQEAFRS 70
            |.|:.||.|||||.|..:|....|....|  .|:|::...|..:::.||||||:|||.|.|...|
  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74

  Fly    71 ITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDSRR-EVKKEEG 134
            :|.|||:.|.||:||:.:....:|:.|:..|.|...:: .|..|.:.|||||||.|. ||..||.
  Fly    75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYA-ENAKIFICGNKSDLDGREPEVSDEEV 138

  Fly   135 EAFARE-HGLV--FMETSARTAANVEEAF---------INTAKEIYEKIQEGVFDINNEANGIKI 187
            |||..: |.|:  ..:||.|:.|.|||.|         .|.:|...:.::...|.::..::|...
  Fly   139 EAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQLVHANRSKMELQALEHKSFQVDTASSGAAT 203

  Fly   188 GQQHSPTNPSLPGAGGAAGAANSGC 212
            .::               .|::.||
  Fly   204 NEE---------------DASSCGC 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab2NP_001260732.1 PLN03108 1..213 CDD:178655 75/220 (34%)
RabX6NP_001261219.1 RAB 10..176 CDD:197555 68/166 (41%)
Rab 10..172 CDD:206640 68/162 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0098
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.