DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab2 and Rab4

DIOPT Version :9

Sequence 1:NP_001260732.1 Gene:Rab2 / 35577 FlyBaseID:FBgn0014009 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_523777.1 Gene:Rab4 / 36992 FlyBaseID:FBgn0016701 Length:213 Species:Drosophila melanogaster


Alignment Length:187 Identity:105/187 - (56%)
Similarity:136/187 - (72%) Gaps:0/187 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQE 66
            :|.||||::|||..|.||||||..|.:.:|:.....|||||||:|::.:.||.:|||||||||||
  Fly     4 TYDYLFKFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVGGKSVKLQIWDTAGQE 68

  Fly    67 AFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDSRREVKK 131
            .|||:||||||||||||||||.|.|::||.||.||.|||..::.|:||:|:|||.||:..|:|..
  Fly    69 RFRSVTRSYYRGAAGALLVYDATSRDSFNALTNWLNDARTLASPNIVILLVGNKKDLEEARDVTF 133

  Fly   132 EEGEAFAREHGLVFMETSARTAANVEEAFINTAKEIYEKIQEGVFDINNEANGIKIG 188
            .|...||:|:.|:|:||||:|..||||||:..:|.|..||:.|..|.....:||:.|
  Fly   134 LEASTFAQENELIFLETSAKTGENVEEAFLKCSKTILAKIETGELDPERIGSGIQYG 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab2NP_001260732.1 PLN03108 1..213 CDD:178655 105/187 (56%)
Rab4NP_523777.1 Rab4 9..169 CDD:206696 94/159 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454220
Domainoid 1 1.000 174 1.000 Domainoid score I866
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100835at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47404
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47979
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.