DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab2 and Rab32

DIOPT Version :9

Sequence 1:NP_001260732.1 Gene:Rab2 / 35577 FlyBaseID:FBgn0014009 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster


Alignment Length:221 Identity:68/221 - (30%)
Similarity:117/221 - (52%) Gaps:31/221 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQI-KLQIWDTAGQEAF 68
            :|:|.::||:.|.||:..:.::..:.|...:..||||:|..:::..|...| :||:||.||||.|
  Fly   482 HLYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQERF 546

  Fly    69 RSITRSYYRGAAGALLVYDITRRETFNHLTTWLED----ARQHSNSNMVIMLIGNKSDLDSRREV 129
            .::||.||:.|.||.:|:|:||..||:.::.|.||    .:....|.:..:|:.||.|.:.:..:
  Fly   547 GNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKCDQEKQGII 611

  Fly   130 -KKEEGEAFAREHGLV-FMETSARTAANVEEAFINTAKEIYEKIQEGVFDINNE------ANGIK 186
             :.|:.:.:.||:|.. :.||||:...|::||    |:.:..||.     ||::      |:|.|
  Fly   612 TQPEKMDEYVRENGFAGWFETSAKENINIDEA----ARALVNKIL-----INDKLISADLADGDK 667

  Fly   187 IGQQHSPTNPSLPGAGGAAGAANSGC 212
            .         :|..|......|.:.|
  Fly   668 F---------NLSAADATGSDAKNKC 684

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab2NP_001260732.1 PLN03108 1..213 CDD:178655 68/221 (31%)
Rab32NP_525109.1 Rab32_Rab38 484..686 CDD:206692 67/219 (31%)
RAB 484..652 CDD:197555 57/171 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454217
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.