DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab2 and Rab14

DIOPT Version :9

Sequence 1:NP_001260732.1 Gene:Rab2 / 35577 FlyBaseID:FBgn0014009 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster


Alignment Length:211 Identity:127/211 - (60%)
Similarity:155/211 - (73%) Gaps:4/211 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQE 66
            :|.|:||||||||.||||||||.|||:|:|......|||||||.|:|.:|.|:||||||||||||
  Fly    31 NYNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQE 95

  Fly    67 AFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDSRREVKK 131
            .||::||||||||||||:|||||||.|:|||::||.|.|..:|.:.||.||||||||:|.|||..
  Fly    96 RFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTY 160

  Fly   132 EEGEAFAREHGLVFMETSARTAANVEEAFINTAKEIYEKIQEGVFDINNEANGIKIGQQHSPTNP 196
            ||.:.||.|:||:|:|.||.|..||||||:.||::||:.||||..|:|...:|:    ||.|:.|
  Fly   161 EEAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGV----QHRPSQP 221

  Fly   197 SLPGAGGAAGAANSGC 212
            |.......|..|...|
  Fly   222 SRTSLSSEATGAKDQC 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab2NP_001260732.1 PLN03108 1..213 CDD:178655 127/211 (60%)
Rab14NP_788056.1 Rab14 34..199 CDD:133322 111/164 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454204
Domainoid 1 1.000 174 1.000 Domainoid score I866
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100835at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47404
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.