DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab2 and Rab21

DIOPT Version :9

Sequence 1:NP_001260732.1 Gene:Rab2 / 35577 FlyBaseID:FBgn0014009 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001036321.2 Gene:Rab21 / 3355163 FlyBaseID:FBgn0039966 Length:222 Species:Drosophila melanogaster


Alignment Length:216 Identity:72/216 - (33%)
Similarity:124/216 - (57%) Gaps:18/216 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITI-DGKQIKLQIWDTAGQEAFRS 70
            ||.:::|:..|||:.|:|::.:.||...|..|:...|.:|.::: ||::.:|.||||||||.|.:
  Fly    14 FKAVLLGEGCVGKTSLVLRYMEDRFNAQHLSTLQASFVSRKMSLEDGRRAQLNIWDTAGQERFHA 78

  Fly    71 ITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDSRREVKKEEGE 135
            :...||||:.|||||||||.|::|..:.:|:.:.||...:.:.::::|||:||:.:|.|..:|..
  Fly    79 LGPIYYRGSDGALLVYDITDRDSFQKVKSWVRELRQMRGTEIALIIVGNKTDLEEQRAVTHDEAL 143

  Fly   136 AFAREHGLVFMETSARTAANVEEAFINTAKEIYEKIQEGVFDINNEANGIKIGQQHSPTNPSL-- 198
            .:||..|..::||||:....|.|.|....:.:.|::.:.    ..:|:.:::   .:|...:|  
  Fly   144 QYARTVGAQYVETSAKENEGVAELFELLTQLMLEQLSQR----QPDASPLRL---QNPDTDNLNN 201

  Fly   199 ------PGAGGAAGAANSGCC 213
                  |..|..||  ...||
  Fly   202 SDDSEAPDPGDPAG--QRSCC 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab2NP_001260732.1 PLN03108 1..213 CDD:178655 70/214 (33%)
Rab21NP_001036321.2 Rab21 14..176 CDD:133323 62/161 (39%)
Ras 15..177 CDD:278499 61/161 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454213
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.