DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab2 and Rab9Db

DIOPT Version :9

Sequence 1:NP_001260732.1 Gene:Rab2 / 35577 FlyBaseID:FBgn0014009 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_572642.1 Gene:Rab9Db / 31993 FlyBaseID:FBgn0030221 Length:197 Species:Drosophila melanogaster


Alignment Length:173 Identity:64/173 - (36%)
Similarity:100/173 - (57%) Gaps:20/173 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIG-------VEFG----ARMITIDGKQIKLQIW 60
            ||.||:||:||||:|||::|:|.:|...|.:|:|       |||.    .||         ||:|
  Fly     8 FKIIILGDSGVGKTCLLMRFSDNQFTERHRVTVGMDRRECSVEFADWRMGRM---------LQVW 63

  Fly    61 DTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDS 125
            ||:..|.|:.:..:..|.|.|.|||||||..::|.::..|:::.|:.....:.::|:|||||..:
  Fly    64 DTSDDERFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVTVLLVGNKSDDPN 128

  Fly   126 RREVKKEEGEAFAREHGLVFMETSARTAANVEEAFINTAKEIY 168
            .|:|...:|..:|....:.|.|.||::..||.:.|.:.|.:||
  Fly   129 HRQVSMAQGFNYAHRQSICFEEVSAKSGRNVYDIFSSLAMDIY 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab2NP_001260732.1 PLN03108 1..213 CDD:178655 64/173 (37%)
Rab9DbNP_572642.1 RAB 8..171 CDD:197555 62/171 (36%)
Rab 8..167 CDD:206640 61/167 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454199
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.