DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab2 and Dnajc27

DIOPT Version :10

Sequence 1:NP_477090.1 Gene:Rab2 / 35577 FlyBaseID:FBgn0014009 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_996727.2 Gene:Dnajc27 / 298859 RGDID:1564414 Length:273 Species:Rattus norvegicus


Alignment Length:172 Identity:54/172 - (31%)
Similarity:96/172 - (55%) Gaps:5/172 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQEAFRSIT 72
            |.|.:|:..|||||::.::.:|||...:..|||:::|...:.:..::||:.|:|.||...|..:.
  Rat    18 KVISMGNAEVGKSCIIKRYCEKRFVSKYLATIGIDYGVTKVQVRDREIKVNIFDMAGHPFFFEVR 82

  Fly    73 RSYYRGAAGALLVYDITRRETFNHLTTWLEDARQ----HSN-SNMVIMLIGNKSDLDSRREVKKE 132
            ..:|:...|.:||||:.::::|:.|.:||.:.:|    |.| .|:|.::..||.|....|.:.:.
  Rat    83 NEFYKDTQGVILVYDVGQKDSFDALDSWLAEMKQELGPHGNMENIVFVVCANKIDCSKHRCIDES 147

  Fly   133 EGEAFAREHGLVFMETSARTAANVEEAFINTAKEIYEKIQEG 174
            ||..:|...|.::.||||:|...:.|.|......|.:..:.|
  Rat   148 EGRLWAESRGFLYFETSAQTGEGINEMFQTFYMSIVDLCENG 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab2NP_477090.1 PLN03108 1..213 CDD:178655 54/172 (31%)
Dnajc27NP_996727.2 Required for interaction with MAPK1. /evidence=ECO:0000250|UniProtKB:Q8CFP6 1..18 54/172 (31%)
RJL 17..184 CDD:133319 53/165 (32%)
DnaJ 217..264 CDD:99751
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.