DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab2 and F11A5.3

DIOPT Version :9

Sequence 1:NP_001260732.1 Gene:Rab2 / 35577 FlyBaseID:FBgn0014009 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_507083.1 Gene:F11A5.3 / 184330 WormBaseID:WBGene00008671 Length:201 Species:Caenorhabditis elegans


Alignment Length:184 Identity:109/184 - (59%)
Similarity:143/184 - (77%) Gaps:1/184 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQEAFR 69
            ::|||:||||.|||||.|||:|||:.|.|:|..|:|||||.:.:.||..:::|::|||.|||.||
 Worm     5 HMFKYVIIGDGGVGKSNLLLRFTDELFDPIHTTTLGVEFGYKDLQIDKYKVRLRVWDTCGQENFR 69

  Fly    70 SITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDSRREVKKEEG 134
            ||.|:|||.|.|||||||||.|::|.||..||.|.|||.:..||||||||||||.:.|:|..|||
 Worm    70 SIIRAYYRNALGALLVYDITCRKSFVHLEQWLSDLRQHGHPEMVIMLIGNKSDLKAVRDVTTEEG 134

  Fly   135 EAFAREHGLVFMETSARTAANVEEAFINTAKEIYEKIQEGVFDINNEANGIKIG 188
            ||||:::||.||||||:...:||:||:|||.|||:|::.||.: :::....|||
 Worm   135 EAFAKKNGLTFMETSAKANKHVEKAFVNTAHEIYKKLKLGVIE-DDDVKKKKIG 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab2NP_001260732.1 PLN03108 1..213 CDD:178655 109/184 (59%)
F11A5.3NP_507083.1 P-loop_NTPase 5..170 CDD:304359 103/164 (63%)
RAB 7..170 CDD:197555 103/162 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159299
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0098
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271975at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47979
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.